(data stored in ACNUC7421 zone)

EMBL: CP000821.PE176

CP000821.PE176       Location/Qualifiers
FT   CDS_pept        complement(200878..201672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0176"
FT                   /product="Carboxylesterase"
FT                   /EC_number="3.1.1.1"
FT                   /note="KEGG: shm:Shewmr7_3882 BioH protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34789"
FT                   /db_xref="GOA:A8FPL6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010076"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPL6"
FT                   /protein_id="ABV34789.1"
FT                   /translation="MNPSPLHIESIGQGQEIIILHGWGVNSAVFTPLHSSLSQYRVHYV
FT                   DLPGFGHSSMIEGDIDAWVDAITSRLSHKAIWVGWSLGGLVATRAALRYPERVQGLVTI
FT                   ASSPCFMAREEESWPGIPPQVLSDFSKQLGSDLSKTIDRFLAIQAMGSVTAKDDIKQLR
FT                   ELVLSRPLPETTALVQGLDMLKSVDLRPQIAQIEQPWLRIWGRLDGLIPRRVPPLMPKD
FT                   EQLYQDLILHRASHAPFISHRDEFITGLVSWIEKLVRDELLR"
     gtgaatccat ctccccttca tatcgagtcc attggtcaag ggcaggagat cattatactt        60
     cacggttggg gggtgaacag tgccgttttt acaccgctac attcttctct gtctcagtat       120
     agggtgcact atgtagatct gcccggtttt ggccatagct cgatgataga gggcgatatc       180
     gatgcctggg tcgatgcgat aacaagcagg ctatcccata aggcgatctg ggtaggctgg       240
     tcattaggtg gacttgtcgc aacccgagcc gcgctgcgtt atcccgaacg ggtacaggga       300
     ctggtcacta tcgcctcctc tccctgcttc atggcaagag aagaggagtc ctggcctggg       360
     atcccgcctc aggtattgtc tgactttagc aagcagctcg gcagtgatct tagtaaaacc       420
     atagaccgct tcttagcaat acaggccatg ggaagtgtaa cggcaaaaga tgatatcaaa       480
     cagcttagag agctggtcct atccaggcca cttcctgaga cgaccgccct ggtgcaggga       540
     ctcgatatgc ttaagagtgt cgatctccgc cctcaaatag cccagattga gcaaccctgg       600
     ctaaggatct ggggacgatt agatggcctg attccgaggc gggttccacc tttgatgcct       660
     aaagatgaac agctctatca ggatctcata ctccacagag cctcccacgc ccccttcatc       720
     tcccacaggg atgagttcat cacaggcttg gtaagctgga tagagaaatt agtcagggat       780
     gaacttcttc gataa                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page