(data stored in ACNUC7421 zone)

EMBL: CP000821.PE177

CP000821.PE177       Location/Qualifiers
FT   CDS_pept        201710..202510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0177"
FT                   /product="competence protein ComF"
FT                   /note="KEGG: shw:Sputw3181_0113 competence protein ComF"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34790"
FT                   /db_xref="GOA:A8FPL7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPL7"
FT                   /protein_id="ABV34790.1"
FT                   /translation="MIKDSIAQRALTGLVKAAQFGRRRLQALYRGVVNLLAASLPNRCL
FT                   MCHQSIELPDSGICSVCLVTGLYQVPVCLGCGRAMQVEAIYCGACTSSRPLMIIAPCSY
FT                   HQGLGEWVGQMKYQTQFSALPVLSHVLANRILYLEEIGLLQLPQVLIPVPLHSNRLRKR
FT                   GFNQAYLIADALTGRLNIPVVTEGLTRTIDTCSQAGLTGKQRRKNLSGAFSLEAHFSYQ
FT                   RIALIDDVVTTGTTAIEIAELFEKRHIHVQIWCLARAEAPGLMD"
     atgataaaag attctatagc gcagcgtgca ttgaccggtt tggttaaggc tgcacagttc        60
     ggcagaagac gattacaggc gctctatcgt ggagtcgtta acctgctggc tgctagttta       120
     ccgaatcgat gtctgatgtg ccatcaaagc attgagttgc ctgattcggg gatctgctcc       180
     gtatgtctag tcaccggtct ctatcaagtt cccgtctgcc tgggctgtgg tcgtgccatg       240
     caagtcgaag ccatctactg tggcgcctgt acctcgtctc gacccctcat gattattgcc       300
     ccctgcagct accatcaagg gttgggagag tgggtcgggc agatgaagta ccagacacaa       360
     ttttcagcat tgccggtgtt atcacatgtg ttagcgaacc ggattcttta cttagaggag       420
     attggattac tgcaacttcc tcaagtatta attccggtgc ccctgcacag taacagatta       480
     aggaagaggg gctttaatca ggcatatctg attgcggatg cccttaccgg caggctcaat       540
     attccggtgg taaccgaagg gctaacccgg actatagata cgtgctctca ggctggatta       600
     acgggtaagc agcggcggaa aaatttgtca ggagccttta gcttagaggc tcacttctcc       660
     tatcagcgta tcgcactgat cgatgatgtc gtgaccacag ggacgacggc aatagagatt       720
     gcggagcttt ttgagaagcg acatattcat gtgcagatat ggtgcctcgc gagggcagaa       780
     gcaccagggt taatggatta g                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page