(data stored in ACNUC7421 zone)

EMBL: CP000821.PE179

CP000821.PE179       Location/Qualifiers
FT   CDS_pept        205299..205877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0179"
FT                   /product="HesB/YadR/YfhF-family protein"
FT                   /note="KEGG: shm:Shewmr7_3880 HesB/YadR/YfhF-family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34792"
FT                   /db_xref="GOA:A8FPL9"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FPL9"
FT                   /protein_id="ABV34792.1"
FT                   /translation="MITISDAAQAHFVTLLADQPEGTHIRVFVISPGTATAECGVSYCP
FT                   PDAVEADDMEFEFNGFNAMVDEKSAPFLEEASIDFVTDQLGSQLTLKAPNAKMRKVASD
FT                   APLSERIDYVIQSEINPQLASHGGNIMLVEVTEEGTAILQFGGGCNGCSMVDVTLKDGI
FT                   ETQLLEKFPGELTGVKDVTEHQHGDHSYQ"
     atgatcacca tttccgatgc agctcaggcc cattttgtta ctttgttagc agatcagcct        60
     gaaggaactc atattcgtgt atttgtaatt agcccaggca cagcaacggc tgagtgtggc       120
     gtttcatatt gtccgcctga cgctgtcgaa gccgatgata tggagttcga gttcaatggc       180
     tttaatgcca tggtcgacga gaagagtgct cctttccttg aagaggcaag cattgacttc       240
     gtcaccgacc aattaggttc acagttaacg cttaaggcgc caaacgctaa gatgcgtaaa       300
     gtggcaagcg acgcaccact gagtgagcgt atcgattatg tgatccagtc agagatcaac       360
     ccgcaacttg cgagtcatgg tggtaacatc atgttggtcg aagtgactga agagggaacg       420
     gctatcctgc agtttggtgg cggttgtaat ggttgctcta tggtcgatgt cacgctaaaa       480
     gatggcattg aaacacagtt actcgaaaag tttcctggcg agctgaccgg tgttaaagat       540
     gtgaccgaac atcaacacgg cgatcactct tatcagtaa                              579
//

If you have problems or comments...

PBIL Back to PBIL home page