(data stored in ACNUC7421 zone)

EMBL: CP000821.PE180

CP000821.PE180       Location/Qualifiers
FT   CDS_pept        complement(206370..207707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0180"
FT                   /product="MATE efflux family protein"
FT                   /note="KEGG: sbl:Sbal_0144 MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34793"
FT                   /db_xref="GOA:A8FPM0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPM0"
FT                   /protein_id="ABV34793.1"
FT                   /translation="MTPVELLRNRQKNRQLLALALPMILSNITVPLLGLVDTAVVGHLS
FT                   NAYYLGGVAVGSTIITLILWMLGFLRMATTGLVAQSFGAGDTQAQYKLLLQAGSLALIL
FT                   GLSAIVLQLPILNGALMLTDATAEVERYCREYFQIRIWSTPFALLNLVLLGWLLGRQQP
FT                   KAAMWQLIVANTVNIALDLLFVLGLDWGVKGAALASVFADISGFLVALMMVYKQVQKTG
FT                   GFDLFKLSKTLSLTSYHQLLSLNADIFIRSLCLQIAFAFMTFQGAGLGDNTVAANAVLL
FT                   NLLLLISYALDGIAYYAEAEVGRAYGQRNKALMRDSVTLAWLWSGISAILFTLLFAFGG
FT                   GAIINLLTSIEAVRLVAEQYLFWIIILPLLSFGSYLFDGVYIGAAMGKVMRNSMIISTF
FT                   GVFFPIWYLLQDMGNHALWAAMSAFMLARSMTLTLHYRYRLRNKGF"
     atgactccag tcgaattact ccgcaacaga cagaagaaca gacagttatt agcactcgcc        60
     ctacctatga tattgtcaaa tatcacagtc cccttactgg ggttggtaga tactgctgtg       120
     gtgggtcatt taagtaacgc ctattattta ggaggagtgg ctgttggctc tacaatcatc       180
     accctcattc tttggatgct cggttttctt cgaatggcga caacaggctt agtcgctcaa       240
     tcctttggtg ccggcgatac acaagcacaa tacaaactct tacttcaagc gggtagtcta       300
     gcgctcattt tagggttaag tgccatagta ctgcaactcc ccatcttaaa tggggcctta       360
     atgctcaccg acgcaacggc tgaagtcgaa cgatattgtc gtgagtattt tcagatacga       420
     atttggtcaa cgcccttcgc cctgctcaac ctagtactct taggctggct gcttggacgg       480
     caacaaccta aagcggcgat gtggcaactg atcgtagcaa acaccgttaa tatagcactg       540
     gatctacttt ttgttctcgg tttagattgg ggagtaaaag gtgccgctct cgcttcggta       600
     tttgccgata tctctggttt tttagtcgcc ttaatgatgg tctataagca agttcaaaaa       660
     actgggggat tcgacctttt caagctcagc aaaacgctta gcctcaccag ctaccatcaa       720
     ctgctcagcc ttaatgccga tatttttatc cgaagcttat gcctgcaaat cgcctttgcc       780
     ttcatgacat ttcaaggcgc gggtctggga gataataccg tcgcggccaa tgccgtactc       840
     cttaacctcc tgcttttgat ctcctatgct ctggatggta tcgcttatta tgcagaagcc       900
     gaagtgggaa gggcctatgg ccagaggaat aaagcgttaa tgcgagacag cgtcacgtta       960
     gcctggctct ggtctggcat ctcagcaatc ctgttcaccc tactcttcgc cttcggtgga      1020
     ggggccatca ttaacctgct aacaagtatt gaagctgtac gactcgtcgc cgaacaatac      1080
     ctgttttgga tcatcatctt gccccttctc tcattcggct cttacctttt cgatggtgtc      1140
     tacataggtg cagctatggg gaaagtgatg cgaaacagca tgatcatctc gacctttggg      1200
     gtgttctttc ccatctggta tctcctgcaa gatatgggta atcatgcact atgggccgcg      1260
     atgagtgcct tcatgttagc gagaagcatg acattgacgc tgcattatcg atatcggttg      1320
     aggaataaag ggttctag                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page