(data stored in ACNUC7421 zone)

EMBL: CP000821.PE182

CP000821.PE182       Location/Qualifiers
FT   CDS_pept        complement(208820..209857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0182"
FT                   /product="Protein-glutamate methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="KEGG: slo:Shew_0109 response regulator receiver
FT                   modulated CheB methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34795"
FT                   /db_xref="GOA:A8FPM2"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPM2"
FT                   /protein_id="ABV34795.1"
FT                   /translation="MIKVLIVDDSPLVRQLLTHLLSDTSDISVVGAAEDPYEARELIKR
FT                   FNPDVLTLDIEMPKMDGIAFLRNLMKLRPMPVVMISTLTEKGAAVTLEALSIGAVDFIS
FT                   KPKSDLTNKLMEYRDELIEKVRFAAKSKVRPTSPIPAPKLCTSPTGCSQNQLIAIGAST
FT                   GGTEAIQRLICQLPSDVPPIVIAQHIPAAFSASFAKRLDSHASMRVIEAQGGELLKPGT
FT                   AYIAPGSAHLIIEKRGGLLYTRLLDSEPVNRHKPSVDVLFDSVAETAGKSALGVILTGM
FT                   GKDGAKGLLNMKQSGAYTLAQDEASSVVWGMPGAAVELDANCEELHIDRIPAKLLSVMK
FT                   NASQA"
     atgataaaag ttttaatcgt tgatgactct ccgctggtta ggcaactact gactcacctg        60
     cttagtgaca cctccgacat cagtgtcgtt ggtgccgccg aagatcccta tgaagccaga       120
     gagctgataa aaagatttaa cccggatgtg ctgactctgg atattgagat gcctaaaatg       180
     gatggaatag ccttcctgcg caatctcatg aagctcagac ccatgcccgt tgtcatgatc       240
     tcgactctca ccgaaaaagg ggcggctgta acgctggaag cactgtccat aggtgccgtt       300
     gacttcatct ctaagcctaa gtcagatctg actaataaac tgatggaata tcgagatgag       360
     ctgattgaaa aggtacgctt cgcagccaag agtaaagtcc gtccaacctc ccccattcca       420
     gcccccaagc tctgcacgtc accgacaggc tgttcacaga atcagctgat tgcgattggt       480
     gcctcgaccg gtggcaccga agctatacag cgtttaatct gccaacttcc ctcagatgtt       540
     cctcccatcg tcatagcaca gcatatcccg gccgcattta gtgcttcatt tgccaaacga       600
     ttggacagtc atgccagcat gagagtgata gaagctcagg gtggagaact attaaagcca       660
     ggaactgcct atatcgctcc gggaagtgct cacctcatca tcgagaaaag aggaggcctg       720
     ctttatacca ggctcttaga tagtgagccg gtcaacaggc ataaaccctc tgtcgatgtg       780
     ctattcgata gtgtcgccga aactgccgga aaatcggcat taggcgtgat ccttaccggt       840
     atggggaaag atggggccaa aggcttgctg aatatgaaac agagcggcgc ttacactctg       900
     gcacaagatg aggccagctc ggtggtttgg ggaatgccgg gggcagccgt agagctggat       960
     gccaattgtg aggagttaca tatagacagg atcccggcaa agctcctgtc agtcatgaaa      1020
     aatgcctcgc aagcttag                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page