(data stored in ACNUC7421 zone)

EMBL: CP000821.PE183

CP000821.PE183       Location/Qualifiers
FT   CDS_pept        complement(209961..210803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0183"
FT                   /product="Protein-glutamate O-methyltransferase"
FT                   /EC_number="2.1.1.80"
FT                   /note="KEGG: saz:Sama_3498 protein-glutamate
FT                   O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34796"
FT                   /db_xref="GOA:A8FPM3"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPM3"
FT                   /protein_id="ABV34796.1"
FT                   /translation="MTQADFDFIQSLAYEKTGIVLPERKKHMVYSRLSRRLRHLNLGNF
FT                   SQYCSHIQRTPDEMINFVNALTTNLTAFFREEHHFKYLESKVIPKWKKNKNRRLRVWSS
FT                   ACSTGEEPYSIAMILEQHFSGVEWDLKVLATDLDTDVLSKASIGSYASDSVTNLPRRYA
FT                   DKYARQTDNGQKVQMRSSVQKMIHFKQLNLLGEWPMKGPFDVIFCRNVLIYFDNETKKK
FT                   IIARFRKLLSPQGYLFIGHSETLTHISEDFDLIGQTIYRPIGHGDNKLQQTKRSVANL"
     atgacacagg cagactttga ttttattcaa agtcttgcct atgaaaaaac gggaatcgta        60
     ctgccggaaa ggaagaaaca catggtgtac tcgagactca gtcgacgatt acgccatctg       120
     aatttaggca atttttcaca atactgctcc catattcaac gtactccgga cgagatgatc       180
     aactttgtaa atgctctcac aaccaatttg accgcatttt tcagggagga gcaccatttc       240
     aaatacctgg agagcaaggt gatccccaaa tggaagaaaa ataagaacag gcgcctcagg       300
     gtttggtcat cggcctgctc taccggcgag gagccttaca gtattgccat gatattggag       360
     caacattttt caggggtaga gtgggacctt aaagttttgg caacggatct tgacaccgat       420
     gtgcttagca aggcctctat tggcagttat gccagtgatt ccgtgaccaa tttacccaga       480
     cgatatgccg ataaatatgc gcgccagact gacaatggtc aaaaagttca gatgcgttcc       540
     agcgttcaga agatgatcca ttttaagcaa ctaaacctat tgggagagtg gccgatgaag       600
     ggaccctttg acgtgatttt ttgcagaaat gtcctcatct atttcgataa tgagactaag       660
     aaaaaaatta tcgccaggtt cagaaagctg ctcagcccgc aaggttacct attcatcgga       720
     cactcggaaa cattgactca tatttctgaa gattttgatc ttatcgggca aacgatttat       780
     agaccgatag gacacggcga taataagttg caacagacga agcgttccgt tgctaacctc       840
     tag                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page