(data stored in ACNUC7421 zone)

EMBL: CP000821.PE185

CP000821.PE185       Location/Qualifiers
FT   CDS_pept        complement(213460..214011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0185"
FT                   /product="CheW protein"
FT                   /note="KEGG: slo:Shew_0112 CheW protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34798"
FT                   /db_xref="GOA:A8FPM5"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPM5"
FT                   /protein_id="ABV34798.1"
FT                   /translation="MTELTQQEQANMDDASQQYLTFIMASEEYGVDILSVQEIRGWEAT
FT                   TVIPNSPSHVKGVINLRGTIVPIIDLRQRFGIETLEYGATTVVIVVKVAMSDEHKVIGI
FT                   VVDAVSDVFSVNDADVRDAPDFGDDTNLSFIKGLTNAADKMVILLDINMLLGSEVLPEA
FT                   SQLSNLINNIDAQQPQAVNA"
     atgacagagc taacccaaca agagcaggcc aatatggatg atgccagtca acaatattta        60
     actttcatca tggctagcga agaatatggt gtcgatattc tttctgtaca agagattaga       120
     ggctgggaag cgacgacagt cattccaaac tcccccagtc atgtgaaggg tgttattaac       180
     ctcaggggga ccatagtacc catcatagat ctgagacaga ggtttggtat tgagactctc       240
     gaatatggag ccacaaccgt agtcatagtc gttaaggttg ccatgtctga tgagcacaaa       300
     gtcataggta ttgttgtcga tgccgtttcc gatgtgttta gtgtgaatga tgccgatgtg       360
     cgcgatgcac ccgattttgg cgacgacact aatctgagct ttataaaagg gcttaccaac       420
     gccgcagata agatggttat cttactggac attaatatgc tcctcggcag tgaggttttg       480
     cctgaagcat ctcaactttc taatttaatt aacaatattg atgcccagca gccacaagct       540
     gttaatgcat aa                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page