(data stored in ACNUC7421 zone)

EMBL: CP000821.PE186

CP000821.PE186       Location/Qualifiers
FT   CDS_pept        complement(214063..216129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0186"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="KEGG: slo:Shew_0113 CheA signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34799"
FT                   /db_xref="GOA:A8FPM6"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPM6"
FT                   /protein_id="ABV34799.1"
FT                   /translation="MEIDLSQFSQVFFEESLEGLESMESELLKLDVNEPEDESINTIFR
FT                   AAHSIKGGSATFGFSQVANYTHLLETLLDEIRDGRRQMTSEHQDMLLLSVDLLRNMIDA
FT                   LMRKTDFDDPLLSQLEKRFTSELEGAAEDIQDEDATQADAEQAPDEQLWHIDFQAGIDI
FT                   LRCGNDPLLMFTELRQLGELTVKLAEINHPDFGDIDPEACYLSWHLELITDQKIERLKE
FT                   VFEWVEDECTIHYSSSVIDTGETRELQGTSESPQASPVPESTQASTSTSDSLPAEVVKP
FT                   KIVSQAKSPEGGSIRVSIEKIDLLINMVGELVITQAMLGQIGQQDEIDEESLLSMKQGL
FT                   EQLASHTRDLQESVMQIRMLPISFAFNRFPRLVRDIGQQLGKKVDLILNGEDTELDKTV
FT                   MEKIVDPMVHLVRNSLDHGLETPEIRVSKGKPETGSITLNAFHQGGNIIIEIIDDGAGL
FT                   DTDRILQKARDKGLVAEDEELSTEAIHQLIFKAGFSTADAVSDLSGRGVGMDVVRRNIN
FT                   ELNGTIELKSTQDKGSRFTIRLPLTLAILDGQLVRIGHHTYVVPLVSIHESLQVEPQRI
FT                   NRISENHELVRLRDEYLPVIKVFQEFDHEADAIEIKDGLVMVVDSNNEKVGLLVDELLS
FT                   QQQVVIKSLEDNYSKVPGVSGATILGDGTVALIIDISGLVSLAGITNTNEHAA"
     atggaaatcg atctcagcca atttagccag gtttttttcg aggaaagcct ggaaggccta        60
     gaaagcatgg agtctgagtt actcaagctt gatgtcaacg agccggaaga tgaatctatc       120
     aacacgattt tcagagctgc acattctata aaaggaggca gcgccacatt cggtttctct       180
     caagtcgcga actacacaca cctgctcgaa actctgctcg atgagataag agatggtcgt       240
     cgccagatga cgagtgaaca ccaagacatg cttcttctct cggtggatct gttgcgtaac       300
     atgatcgatg ccctgatgcg caaaacagac ttcgatgacc cgttattatc tcaacttgaa       360
     aaacggttta cttcggagct agagggggcc gcggaagaca ttcaagatga ggatgctaca       420
     caagccgatg ctgaacaggc acccgatgag caactctggc atatagattt tcaggccgga       480
     atagatattc tgcgatgcgg gaacgatccc ctgctcatgt tcacagaact aagacagctg       540
     ggtgaactca ccgttaagtt agccgagata aatcacccgg attttggcga tatagacccg       600
     gaagcctgtt acctcagttg gcaccttgaa ctcatcacgg atcaaaaaat tgaacgtctg       660
     aaagaggtat ttgaatgggt cgaagatgag tgcacgattc actacagttc atcggtcata       720
     gataccgggg agacaagaga gctccaaggc acttccgaat cacctcaggc ttctccagtg       780
     cctgaatcaa ctcaggcatc aacttcgaca tcagatagcc tacccgctga ggtggttaag       840
     cccaaaatcg tttcgcaagc aaaatctccc gagggtggct ccattcgagt cagcatagag       900
     aaaattgatc tactcataaa tatggtcgga gagctggtca ttacccaggc gatgttaggt       960
     cagataggtc aacaagatga gatcgatgag gaatcattac tatccatgaa acaagggtta      1020
     gagcaactcg cctcacatac ccgggacctt caagaaagcg tcatgcagat cagaatgtta      1080
     cccatcagct ttgccttcaa tcgcttcccc agactcgtta gagatattgg tcagcaatta      1140
     ggcaaaaagg tcgatttaat ccttaatggg gaagacaccg agctggataa aacggtaatg      1200
     gagaaaattg tcgaccctat ggtacatctg gttagaaact cactggatca tggtctggaa      1260
     acacctgaaa tacgggtcag taaaggcaag ccagaaacgg gcagcattac gctcaacgct      1320
     ttccatcaag gtggcaatat cattatcgag atcatcgatg atggtgccgg gctggatact      1380
     gataggatac ttcaaaaagc cagagataaa ggcttggttg cagaagatga agagcttagt      1440
     acagaagcga ttcatcaact tattttcaag gctgggttct ctaccgctga tgccgtctcc      1500
     gatctatccg gcagaggcgt tggcatggat gtcgttcgcc gaaacattaa tgaactcaac      1560
     ggcaccattg aacttaagtc gactcaagat aaaggtagcc gtttcaccat acgtcttccg      1620
     cttactctgg caattctcga cggccagctg gtaagaatag gtcatcacac ctatgtcgta      1680
     ccactcgtct caattcatga atctttgcag gtagaaccac aacgcatcaa tcgtatcagt      1740
     gagaaccatg agctggtcag gctaagagat gaataccttc cggtgatcaa agtgtttcaa      1800
     gagttcgatc atgaagccga tgccatcgag attaaagatg gtctggtcat ggtcgttgac      1860
     tccaataatg aaaaagtcgg cttactcgtc gatgaactgt tatcccagca acaggtggtt      1920
     atcaaaagtc tggaagacaa ctatagcaag gtgcccggcg tttcaggagc cactattctt      1980
     ggtgatggaa ccgttgcttt aattattgat atttctggat tagttagcct ggcaggcatc      2040
     actaatacca atgagcatgc agcttaa                                          2067
//

If you have problems or comments...

PBIL Back to PBIL home page