(data stored in ACNUC7421 zone)

EMBL: CP000821.PE187

CP000821.PE187       Location/Qualifiers
FT   CDS_pept        complement(216175..216537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0187"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: saz:Sama_3494 response regulator receiver
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34800"
FT                   /db_xref="GOA:A8FPM7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPM7"
FT                   /protein_id="ABV34800.1"
FT                   /translation="MKRILAVDDSASMRQMVGFTLKTAGFDVTEASNGDEALKVAQKGE
FT                   YDLVISDVNMPVMDGLTLIRNLRTLPAYKFTPLLMLTTESGTDKKQEGRSAGATGWIVK
FT                   PFNPDQLLATVRKVLG"
     atgaagagaa tattagcagt cgacgactca gcatcgatgc gccaaatggt gggctttaca        60
     cttaaaaccg cagggtttga tgtgactgag gcgagtaatg gcgacgaagc attaaaagtc       120
     gctcagaagg gagagtatga tcttgtcatc tccgatgtaa acatgcccgt catggatgga       180
     ctcaccctca ttcggaacct acgtacacta cccgcctata aatttactcc gttattaatg       240
     ctgaccacag agtcaggaac agacaagaaa caggaaggtc gttcagctgg tgccactggc       300
     tggattgtaa aacccttcaa tccggatcaa cttctagcaa ctgtccggaa agtactgggt       360
     tag                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page