(data stored in ACNUC7421 zone)

EMBL: CP000821.PE188

CP000821.PE188       Location/Qualifiers
FT   CDS_pept        complement(216534..216830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34801"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPM8"
FT                   /protein_id="ABV34801.1"
FT                   /translation="MTDQTIKLDSELTIRNIQPIFARLSELLTHDKLLHIDVSQLSRVD
FT                   TAGAQLLYLFSQTCNARSLKVEWQGGQPELRSNLKSLGIVIPELQSDTQEKML"
     atgacggatc aaaccattaa attagattca gaattaacca ttagaaatat tcagcccata        60
     tttgcgcgac tttctgagct attaacacac gataaattac tccatataga cgtcagtcaa       120
     ctatcccgtg tcgatacagc tggtgctcaa ctcctttatc tattttccca aacatgcaat       180
     gcacgctccc taaaggttga atggcaaggg ggtcagccgg agctaagatc taacttaaaa       240
     agcttaggta tcgtcatccc ggaacttcag agtgatacac aggagaagat gctatga          297
//

If you have problems or comments...

PBIL Back to PBIL home page