(data stored in ACNUC7421 zone)

EMBL: CP000821.PE189

CP000821.PE189       Location/Qualifiers
FT   CDS_pept        complement(217009..217665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0189"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="KEGG: shw:Sputw3181_0125 electron transport protein
FT                   SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34802"
FT                   /db_xref="GOA:A8FPM9"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPM9"
FT                   /protein_id="ABV34802.1"
FT                   /translation="MNKRLTRVVAALLAVVIVGLGSFTALQFQSMSEEVSQIELSNSFV
FT                   YPTPKRLPQFKLMEQHGTSFTNADLKGKWSLFFIGYTSCPDVCPTTMAKLTAAYPELLE
FT                   SADIQVIFLSVDPQRDTQDKLLNYMDFFNPKFIALTGDHTQLFPLTRSLGFVYAMVGDG
FT                   ENYQIDHSASMALISPEGENIAIIKPKSSTPGTLPQITSQALISDIHQIIQRKNG"
     atgaataaac gtttaactcg ggttgttgca gcgcttctgg ctgttgtcat agtaggtctg        60
     ggaagcttca ccgcgcttca atttcaatcg atgagtgaag aggtgagcca gatagagtta       120
     tccaatagct ttgtctaccc tacccccaaa agactgccgc aatttaagct gatggagcaa       180
     catggcacct ctttcactaa tgctgactta aagggtaagt ggagcctgtt tttcataggc       240
     tatacctctt gtcccgatgt ttgcccgacc actatggcca aactcacagc ggcttatccc       300
     gaactgttgg agtccgccga tatacaggtg atttttctct ccgtcgatcc ccaaagagac       360
     acgcaagata agctattaaa ctatatggat ttctttaacc ccaaattcat cgcgttaacg       420
     ggagaccaca cacagctatt ccctctaacc cgaagcctgg gcttcgtata tgccatggtc       480
     ggagatggag aaaactatca aatcgatcat agtgcatcga tggcacttat ctcacccgaa       540
     ggagagaata tagccatcat taagcctaag tcttcaactc ccggtacact ccctcaaata       600
     acgtcacaag ccctcatctc agacattcat caaatcatac aaagaaaaaa tgggtga          657
//

If you have problems or comments...

PBIL Back to PBIL home page