(data stored in ACNUC7421 zone)

EMBL: CP000821.PE19

CP000821.PE19        Location/Qualifiers
FT   CDS_pept        complement(24405..24845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34632"
FT                   /db_xref="GOA:A8FP59"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP59"
FT                   /protein_id="ABV34632.1"
FT                   /translation="MKKLIGIGFKPIKQGPMTLVESANVTQTHGVEQDFFGRPGKRQIT
FT                   VMSKDQWQLVCAELDSPLPWTTRRANLLIEGHCFCAADQGKLLRIGKLTLEITGETDPC
FT                   KKMEIAHAGLEAALTPDWRGGVTCRVLNDAIINKGDLVQLLS"
     atgaagaaac ttataggtat cgggtttaaa ccaatcaagc aaggccctat gacgttagtt        60
     gagtcggcta acgtcaccca gactcatggt gtagagcaag atttctttgg gcgtccgggt       120
     aaacgtcaga tcacggtaat gtccaaagac caatggcaac ttgtttgcgc cgagctcgat       180
     tcaccgcttc cctggacgac ccgacgtgca aacctgttga tcgaaggaca ctgtttctgt       240
     gccgcagatc aaggtaagtt attacgtatt ggcaagctga cactcgagat caccggcgaa       300
     accgatccct gtaaaaaaat ggaaatagcg cacgcagggc tcgaagcggc actgactccg       360
     gattggcgtg gcggtgtgac ctgccgggta ttaaacgatg ccataatcaa taaaggcgat       420
     cttgttcaac tgctaagcta a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page