(data stored in ACNUC7421 zone)

EMBL: CP000821.PE192

CP000821.PE192       Location/Qualifiers
FT   CDS_pept        complement(219698..220243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0119 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34805"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPN2"
FT                   /protein_id="ABV34805.1"
FT                   /translation="MNSPKKSGAKPLIILLLVFLLPVVAAKIVLSMNLYHGGATNKGEL
FT                   LSPETSYASLAMENPRPHEWQILYLLPSDCDALCLDRLYILKQSHIALGREQNRVHTMI
FT                   LLTESSDISALKLHSFETVKASTAMINILNDQQMVIVDPLGSLVMRYSKVSGRAKQILQ
FT                   GKSLVSDLRKMLKLSRVG"
     atgaactccc ccaagaagag cggtgccaaa ccactgataa ttttattatt ggtcttttta        60
     cttcctgttg tcgccgcaaa aattgtactt agcatgaatc tctatcatgg tggtgcgacc       120
     aataaaggtg aactgctctc ccccgaaacc agttatgcca gcttggcaat ggaaaatccc       180
     agaccccatg aatggcagat tctttatctg ctccccagcg attgtgacgc cttgtgcctg       240
     gatcgtctct atatcctcaa gcagagccat attgcactgg gcagagaaca aaacagggtt       300
     cacaccatga ttttactcac cgaaagcagc gatatctcgg cactaaaact tcactctttc       360
     gaaacagtta aagccagcac cgcaatgata aacatactca acgaccagca gatggtcatt       420
     gttgaccctc tgggaagttt agtcatgcgt tactcgaagg tctcaggtcg agccaaacag       480
     atcctgcagg gtaaatcctt agtttcagac ttaagaaaaa tgcttaagtt atcgagggtc       540
     gggtaa                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page