(data stored in ACNUC7421 zone)

EMBL: CP000821.PE193

CP000821.PE193       Location/Qualifiers
FT   CDS_pept        complement(220444..221202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0129 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34806"
FT                   /db_xref="GOA:A8FPN3"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPN3"
FT                   /protein_id="ABV34806.1"
FT                   /translation="MKTNNVFTRYPQLYLVGSRALLIIITVSLFLFLVKLGFWQLSRAE
FT                   EKELWQTQLTTRQAADSLSYAELLSLPEAESLTGYRLTVTAQPLAEQVFLLDNQVFNGR
FT                   VGYLALQLMEVTPDRPWLLVELGFIPATANRESLPAIKPITMSQSLTGRLYQKQSNPMS
FT                   SALMAEPGWPKRIQNLNVGEMRDLVNRPIAAAVLQPETIKGIDLPHPWKPIPLSAQKHR
FT                   GYALQWFSMAFAFAILVLFFIYSRKRRKNR"
     ttgaaaacaa ataatgtatt cactcgttat cctcaactgt atctggtggg ttcaagagcc        60
     ttgcttatta ttatcactgt gagtctgttt ctctttttgg tcaagttagg attctggcaa       120
     ctgtctcgcg ccgaagaaaa agagttatgg cagacccaat tgacgacacg tcaagctgcc       180
     gactcactct cttatgcaga gctactatca ctacctgaag cagagtcact aacgggatac       240
     cgactcacag taactgcaca gccgctcgct gagcaggttt ttctactcga taatcaggtc       300
     tttaatggca gggttggtta cttagcactg caacttatgg aggtcactcc cgatcgacct       360
     tggttgctgg ttgagttagg ttttataccc gcaaccgcaa acagggaaag cttacccgca       420
     ataaagccaa taacaatgag tcagagcctt accgggcggc tatatcagaa acagagtaac       480
     ccgatgagca gcgcactcat ggccgaaccg ggttggccaa aacgcattca gaatcttaat       540
     gtcggcgaaa tgcgtgattt ggtcaatcgt cccatagccg cagctgtact tcagcccgaa       600
     acaattaagg gcattgactt gcctcatccc tggaaaccga tcccgctgtc ggctcaaaaa       660
     cacaggggct atgcgctaca gtggttttcg atggctttcg cattcgcgat attagtccta       720
     ttctttattt acagcagaaa acgaagaaag aacagatag                              759
//

If you have problems or comments...

PBIL Back to PBIL home page