(data stored in ACNUC7421 zone)

EMBL: CP000821.PE194

CP000821.PE194       Location/Qualifiers
FT   CDS_pept        221213..221398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0121 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34807"
FT                   /db_xref="GOA:A8FPN4"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPN4"
FT                   /protein_id="ABV34807.1"
FT                   /translation="MLLLLFIVFNLAKALFLLVKGDSETPMSQFLGRRVIFSVVAVLII
FT                   LLAIGTGILSPNPRPY"
     gtgctgttac tgctattcat tgtttttaat ttagccaaag ccctattctt gttagttaag        60
     ggagactctg aaacgccgat gagtcaattt ttggggcgca gggttatctt ttctgtcgtc       120
     gctgtgttga tcatattgct ggcgataggg acgggaatac tctctcccaa ccccagaccc       180
     tattaa                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page