(data stored in ACNUC7421 zone)

EMBL: CP000821.PE195

CP000821.PE195       Location/Qualifiers
FT   CDS_pept        complement(221470..222345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0195"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /note="KEGG: slo:Shew_0122 cytochrome c oxidase, subunit
FT                   III"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34808"
FT                   /db_xref="GOA:A8FPN5"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPN5"
FT                   /protein_id="ABV34808.1"
FT                   /translation="MTSKHEHYYVPAQSAWPIIGALGLFLIAFGAGSYVQQLKTDGGSG
FT                   GFILLAGIAVIIFMIFGWFRTVIAESMSGLYSKQMDRSFRQGMSWFIFSEVMFFAAFFG
FT                   ALLYARMIAVPWLGGDSNNAMTNEVLWPGFEAVWPLVMTPGGTQTEAMGWTGLPLYNTI
FT                   ILLTSSVTLHFAHVSLEKEKRSAIAIWLGITILLGMGFLVLQAEEYIHAYREMGLTLSS
FT                   GVYGNTFFLLTGFHGMHVTLGTVFLMVLFLRVLKGHFTPEKHFAFQAGSWYWHFVDVVW
FT                   LCLFIFVYVL"
     atgacaagta agcacgaaca ctattatgtt cccgcacaga gtgcatggcc aattatcggt        60
     gccttagggt tattccttat cgcctttggt gctggaagtt acgtacaaca acttaaaacc       120
     gatggcggca gcggtggatt tatcttgctc gcgggcatcg ccgtcatcat ttttatgatt       180
     tttggctggt tcagaaccgt tatcgccgaa tccatgagtg gcctctactc aaagcagatg       240
     gatcgctcat tcagacaggg aatgagctgg tttatcttct ctgaagtgat gtttttcgcc       300
     gccttttttg gcgcactact ctatgcgaga atgattgcag tcccctggtt gggcggtgat       360
     tcaaataacg ccatgaccaa tgaggttctc tggcctggct ttgaagcggt ttggcccctg       420
     gtgatgacac ccggtggaac ccaaactgaa gcgatgggct ggaccggact gccgctatac       480
     aacaccatta tcctgctcac ctcgtcggtt accctccact ttgcccacgt cagtctggag       540
     aaagaaaaac gttctgccat cgcaatctgg ctgggcataa ccatattgct cggtatgggt       600
     ttcctggtat tacaagccga agaatatatc cacgcttatc gggagatggg gctgacactg       660
     tcttccggcg tctatgggaa tacgtttttc ttgcttaccg gctttcatgg tatgcatgtc       720
     accctaggta cagtgtttct tatggtgcta tttcttagag tgcttaaggg acactttacc       780
     ccagagaagc acttcgcatt tcaggcagga agttggtact ggcactttgt ggatgttgtc       840
     tggttgtgcc tgtttatttt cgtctacgtc ctttga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page