(data stored in ACNUC7421 zone)

EMBL: CP000821.PE196

CP000821.PE196       Location/Qualifiers
FT   CDS_pept        complement(222342..222911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0196"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /note="KEGG: slo:Shew_0123 cytochrome c oxidase assembly
FT                   protein CtaG/Cox11"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34809"
FT                   /db_xref="GOA:A8FPN6"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPN6"
FT                   /protein_id="ABV34809.1"
FT                   /translation="MAKNLANANRKLISWLIAAAIGMFGFGFALVPLYDVLCEQLGING
FT                   KTQSTASSYEPVTIDKNRTITVEFMAQIQSDLPWEFKPEVKRLRVHPGELVRTNFNAKN
FT                   LSMIELVGQAIPSVSPGQGAAYFNKTECFCFNQQRLTAKASAELPLIFYVDPDLPDSIT
FT                   TLTLSYTLYNITDREYVSVVEQGAAK"
     atggctaaga acctggcgaa cgctaaccga aagcttatca gctggctcat tgctgcggcg        60
     ataggcatgt tcggctttgg cttcgctctg gttcccctgt atgacgtgct ctgtgaacag       120
     ctggggataa atggcaaaac ccagagcacg gccagcagtt atgagcctgt cactattgat       180
     aaaaaccgca ccataaccgt tgaatttatg gcacagatac aaagtgatct gccttgggaa       240
     tttaaacctg aggtgaagcg cctgcgagtt caccccggag agttagttcg cactaacttt       300
     aatgccaaaa acctctccat gattgagctt gtaggacaag caatcccctc tgtatccccc       360
     ggacagggag ccgcctactt caataaaaca gagtgcttct gctttaatca acagagatta       420
     acagcaaaag ccagtgcaga gttaccactg atattttacg tggatccgga tcttcctgat       480
     tccataacga cactgactct ctcttatacc ctctacaaca tcaccgaccg tgagtatgtc       540
     agcgttgtag agcaaggagc agcaaaatga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page