(data stored in ACNUC7421 zone)

EMBL: CP000821.PE198

CP000821.PE198       Location/Qualifiers
FT   CDS_pept        complement(224528..226102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0198"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: slo:Shew_0125 cytochrome c oxidase, subunit
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34811"
FT                   /db_xref="GOA:A8FPN8"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPN8"
FT                   /protein_id="ABV34811.1"
FT                   /translation="MKQKLYGLPALLFSPSILAADMPLNMTQGVTEISGRVYNLHMIIL
FT                   YICCAIGILVFGVMIYSMINHRKSRGAVAANFHESTKVEIAWTLVPFIILVLMAIPATK
FT                   TLIAMEDPSDADLTIKITGSQWKWHYSYFDHDLEFYSLLSTPREQIEGTEVKGENYLLE
FT                   VDKPLVLPVNKKVRFLMTSDDVIHSWWVPAFAVKKDANPGFINEAWTRIDKPGVYRGQC
FT                   AELCGKDHGFMPIVVEALSEVDFDKWVIAQKQQANNAEAEAKAALSKTLSMEELMAKGE
FT                   QIYLARCAACHQPNGAGLPGVFPSLIGSPITIGPVAAHVDIVVNGKPGTAMQAFAKQLN
FT                   ATEIAAVVTFERNAWGNDSGDTVQAADVSSGGSSSAASNDSSTAIPATLPASQPETEQV
FT                   KTAVAETASKVVEEVEAVVLDDLTMDELMAVGEKVYMTHCVACHQAAGTGLPGAFPSLV
FT                   GSPVITGPISGHLDVVINGKPGTAMQSFSSLLTPQQLAAVVTYERNAWGNNSGDTVQAS
FT                   DVVGHGN"
     gtgaagcaaa agttgtatgg tttgccggcg ttattatttt cgccttctat cttagctgcg        60
     gatatgcccc tgaacatgac tcaaggggta acagagatta gtgggcgggt gtacaacctg       120
     cacatgatca ttctgtacat ctgttgcgct atcggtattc tggtgtttgg cgtgatgatc       180
     tactcgatga tcaaccatcg caaatccaga ggtgcggtag ctgctaactt ccacgaaagt       240
     actaaagtcg agatagcctg gacgctcgtt cctttcatca ttctcgttct tatggctatt       300
     cctgcgacca agaccttaat cgcaatggaa gacccttcag atgccgatct gacaatcaaa       360
     atcaccggtt ctcagtggaa gtggcattac agctatttcg atcacgatct cgaattttac       420
     agcttgctct caaccccaag agaacagata gagggtactg aagtaaaagg cgaaaactac       480
     ctcctcgaag tcgacaaacc tttagttctc ccggtaaaca agaaagtcag atttttaatg       540
     acctccgacg atgtcatcca ctcctggtgg gtgccagcgt ttgcagtgaa aaaagatgcc       600
     aatccgggtt ttatcaatga ggcctggaca cggattgata agcccggtgt ttaccgcggt       660
     caatgtgccg aactttgcgg caaagaccac gggtttatgc cgatcgttgt cgaagctctt       720
     tcagaagtag actttgataa gtgggtgatt gctcagaagc agcaagcgaa caatgcagaa       780
     gctgaagcga aagccgcact ttcgaaaacg ttgagcatgg aagaactcat ggctaaaggc       840
     gagcaaatct acctagctcg atgtgccgct tgtcatcaac ctaatggcgc tggtctaccc       900
     ggtgtattcc cttctcttat tggtagcccc ataaccatag gccctgtcgc ggctcatgtc       960
     gatatcgtcg tcaatggtaa accaggaacg gctatgcaag cttttgctaa gcaactaaat      1020
     gctactgaaa ttgctgcggt agtgactttt gagcgtaatg cttggggcaa tgactctggt      1080
     gatactgtcc aagcagctga tgtcagctct ggtggttcga gttctgcagc ctccaacgat      1140
     tcaagcaccg caatccctgc cactttacca gcaagccagc ctgagactga gcaagttaaa      1200
     acggctgtgg ctgaaacggc aagcaaagtt gttgaggaag ttgaagcggt tgttttagat      1260
     gacttaacga tggatgaact tatggccgtg ggtgagaagg tctacatgac tcattgtgtt      1320
     gcttgtcacc aggctgcagg taccggatta cccggcgctt tcccttcatt agtcggcagc      1380
     ccagtgatca caggaccaat aagcggtcat ctcgatgttg tcatcaatgg taaaccgggt      1440
     actgcaatgc agtcatttag ctcactactc acgccacaac agttagctgc ggtggtgact      1500
     tatgagcgca atgcatgggg taataactcc ggtgataccg ttcaggcttc tgacgttgtt      1560
     ggtcacggaa attaa                                                       1575
//

If you have problems or comments...

PBIL Back to PBIL home page