(data stored in ACNUC7421 zone)

EMBL: CP000821.PE199

CP000821.PE199       Location/Qualifiers
FT   CDS_pept        complement(226521..227033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_0155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34812"
FT                   /db_xref="GOA:A8FPN9"
FT                   /db_xref="InterPro:IPR004596"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPN9"
FT                   /protein_id="ABV34812.1"
FT                   /translation="MNSLIGNSPRHPGLWVNLEDPLSNELQGCTVSSVTTHTQGRDELQ
FT                   MLSAQLASLSHRGQWIVLISPPNIGYKQMLTDAGVRMDRVLLVHAKDEVETLWAMEKAL
FT                   TSGTSSAVISWTQSLDARDNRRLQIVAKSARAVGIVIEVANGHLHGKAHMNGVEAFNQP
FT                   SLFGSLH"
     atgaactcat taattggcaa cagtccacgt caccctgggt tatgggtaaa tcttgaagat        60
     ccattatcga atgaactgca aggctgcaca gtctcttcag taacaactca tacccaaggg       120
     cgtgatgaat tgcagatgct gagtgcccaa ctggcttcat tgagtcatcg aggtcagtgg       180
     attgtgctga ttagtcctcc gaacataggt tacaaacaga tgttaaccga tgccggagtg       240
     aggatggata gagtcctgct cgttcatgct aaagatgaag ttgaaaccct gtgggccatg       300
     gaaaaagcac tcacaagtgg tacatccagt gccgttataa gttggaccca atccttagat       360
     gcaagagata atcgtcgcct acagatcgtc gctaaaagtg ctcgtgcagt aggtattgtg       420
     attgaagttg cgaatggcca cttacatgga aaagcccaca tgaacggcgt tgaggcattt       480
     aatcaaccca gtttgtttgg ttcattacac tag                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page