(data stored in ACNUC7421 zone)

EMBL: CP000821.PE2

CP000821.PE2         Location/Qualifiers
FT   CDS_pept        complement(1997..3631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0002"
FT                   /product="60 kDa inner membrane insertion protein"
FT                   /note="KEGG: slo:Shew_3866 60 kDa inner membrane insertion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34615"
FT                   /db_xref="GOA:A8FP42"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FP42"
FT                   /protein_id="ABV34615.1"
FT                   /translation="MESQRNILLIGLLFVSFLLWQQWQTDQAPQPVAMESSSTIPSSST
FT                   SDSHSSDVPDADSALPAAVVASKELITVNTDQLIIKINPIGGDIVYSALVEHKLELDKD
FT                   EPFVLLEQTKDINYIAQSGLIGRNGIDSSSKGRAHFDSASREYTLASGQDTLEVPLTFV
FT                   ADNGATYTKMFVFHRGQFKVDVDYVIDNSTDQQLQVQMYGQIKHSIKQSESSMMMPTYR
FT                   GAAFSTANTRYEKYSFDDMADKNLDEKTLGGWAAMLQHYFVSAWVPPANDQNIIFSSIS
FT                   AGGQANIGFRGAVYDVAPGATQTINSEFYVGPKNQEALSAISESLNLVVDYGFLWWLAV
FT                   PIYKLLMFFQSLVTNWGLAIILITLTVRGMLYPLTKAQYTSMAKMRNLQPKLAEMKERF
FT                   GDDRQKMGQAMMELYKKEKVNPMGGCLPILLQMPIFIALYWVLLESVELRHAPFMLWIT
FT                   DLSVQDPYYVMPILMGISMFVMQKMQPMAPTMDPMQQKMMQWMPVVFTVFFLWFPAGLV
FT                   LYWLVGNLVAITQQKIIYAGLAKKGLK"
     atggaatctc aacgcaatat attgcttatc ggtctgcttt ttgtcagctt tttgctatgg        60
     caacagtggc agactgatca ggccccacaa ccggtagcga tggaatcttc atcaactatt       120
     ccgtcttcgt ctacttcaga ttctcacagc tctgacgttc cagatgccga ctcagcactt       180
     cctgctgctg ttgttgcttc taaagaactc atcacagtga acaccgatca gttaatcatt       240
     aagattaacc ctatcggtgg tgatatcgtt tattccgcac tcgttgaaca caaacttgag       300
     ctggataaag acgagccttt tgttctttta gaacaaacga aagatataaa ctacattgct       360
     caaagtggtc ttatcggtcg taacggtatc gacagcagct ctaagggccg tgcacacttc       420
     gacagtgctt cacgcgaata caccttagcc tctggccagg ataccttaga agttccgctt       480
     actttcgttg ccgacaatgg tgcgacttac actaagatgt ttgtcttcca tcgtgggcaa       540
     tttaaagtgg atgtcgacta tgtcatcgac aacagcactg accaacagct gcaagttcag       600
     atgtacggtc agattaagca cagcatcaag caaagcgaaa gcagcatgat gatgccgact       660
     taccgtggtg ccgctttctc tactgcaaat actcgctacg aaaagtacag cttcgatgat       720
     atggctgata agaacctgga tgagaaaaca ttaggtggtt gggctgcaat gcttcaacac       780
     tactttgttt ctgcttgggt accaccagcc aacgatcaga acattatttt ctccagcatc       840
     agtgccggtg gacaagccaa tatcggtttc cgtggtgcag tctatgatgt cgcgccgggt       900
     gcaactcaaa cgatcaactc tgagttttat gttggtccta agaatcaaga agccctatcg       960
     gccatctctg aatcacttaa cctggtagtc gattacggtt tcctttggtg gttagccgta      1020
     cctatctaca agttactgat gttcttccag tcattagtca ctaactgggg tcttgcgatt      1080
     atccttatca cgttaaccgt acgtggtatg ttgtacccgt taacgaaagc tcagtacacc      1140
     tctatggcta agatgcgtaa cctgcaacct aagcttgctg agatgaaaga gcgcttcggt      1200
     gatgaccgtc agaagatggg tcaggcgatg atggagctgt acaagaaaga gaaagtaaac      1260
     cctatgggtg gctgtcttcc tatcttgcta cagatgccaa tcttcatcgc cctatactgg      1320
     gtactgctgg agagtgttga gctacgtcac gcgccattca tgctttggat caccgacctt      1380
     tcggtacaag atccatacta tgtaatgcca atcctgatgg gtatctcgat gttcgtcatg      1440
     cagaagatgc agccaatggc accgacgatg gacccaatgc aacagaagat gatgcagtgg      1500
     atgccggtag tatttaccgt attcttccta tggttccctg caggtctggt actttactgg      1560
     ttagtcggta acttagttgc gattacgcag cagaagatta tctatgccgg tctggcgaag      1620
     aaaggcttaa aatag                                                       1635
//

If you have problems or comments...

PBIL Back to PBIL home page