(data stored in ACNUC7421 zone)

EMBL: CP000821.PE20

CP000821.PE20        Location/Qualifiers
FT   CDS_pept        complement(24870..25115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0020"
FT                   /product="SirA family protein"
FT                   /note="KEGG: slo:Shew_0015 SirA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34633"
FT                   /db_xref="GOA:A8FP60"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FP60"
FT                   /protein_id="ABV34633.1"
FT                   /translation="MSDPFSEAQHQLDALGLRCPEPVMMVRKSVRKMAQGETLLIIADD
FT                   PATTRDIPSFCEFMDHKLLASQTDSTPYQYLIQKGL"
     atgagcgacc cattttcaga agcacaacac caactcgatg ctctcggact caggtgcccg        60
     gagccggtca tgatggttcg taaatcagta cgcaagatgg ctcagggtga aacactattg       120
     atcatcgccg atgatccggc cacgactcgt gatattccca gcttctgtga atttatggac       180
     cataaactgc tggccagcca aacagactcg acgccctacc aataccttat tcagaaaggc       240
     ttataa                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page