(data stored in ACNUC7421 zone)

EMBL: CP000821.PE202

CP000821.PE202       Location/Qualifiers
FT   CDS_pept        230224..231480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0202"
FT                   /product="aromatic amino acid transporter"
FT                   /note="KEGG: slo:Shew_3531 aromatic amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34815"
FT                   /db_xref="GOA:A8FPP2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR013059"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPP2"
FT                   /protein_id="ABV34815.1"
FT                   /translation="MANHMNAAKDGAASKSLLGGAMIIAGTAVGAGMFSLPVVGAGMWF
FT                   SYSLVMMLGVWFCMLVSGLLLLETNLHFEPGDSFDTLTRETLGNFWRIVNGLSIAFVLY
FT                   ILAYAYISGGGSIVNHSLAAAGIELPQSLAGLVFALGLAFIVFISTKAVDRITTIMLGG
FT                   MIITFFLAVGNLLIEIDTVKLFTPDGESRYLPYMLAAIPFGLVSFGYHGNVPSLVKYYG
FT                   KDASTIIKAIVTGTLIAFVIYVCWLVATMGNIPRNDFVDIIAQGGNMGVLVSALSDVMS
FT                   SGWLTTMLTVFANLAVASSFLGVTLGLFDYLADLFGFDESRSGRFKTAAVTFLPPTVLG
FT                   LLFPNGFLIAIGFAALAATIWAAIVPAMMAYKARKLYPNSESFRVPGGTFVIAIVILFG
FT                   VVTGACHLLAMAELLPVYG"
     atggctaacc atatgaacgc tgctaaagat ggagcagcga gtaaatcttt gcttggtgga        60
     gccatgatca tcgccggaac tgcggtcggg gcgggaatgt tctcattgcc tgttgtgggt       120
     gccggtatgt ggttttccta ttcacttgtc atgatgttag gtgtctggtt ctgtatgctg       180
     gtgtcgggtc tgttgttact cgagaccaat ctacacttcg agcccggtga tagcttcgat       240
     accctgacac gggaaacctt aggtaacttt tggcgaatag tgaatggttt atcaatcgca       300
     ttcgtactct atattttggc ctatgcctat atcagtggtg gcggctctat cgttaatcac       360
     agtttagcgg ctgcagggat cgaactgcca caaagcttgg ccgggctggt atttgcgctg       420
     ggtttggcct ttatcgtctt tatcagtact aaggctgtcg ataggatcac gaccattatg       480
     cttggcggaa tgatcatcac tttctttctc gccgtaggta atttactgat agagatcgat       540
     acggtgaagt tgttcacgcc agatggagag agccgatatc tgccctatat gttggcggct       600
     atcccctttg gattagtgag ctttggttat catggtaatg tgcccagcct ggttaaatac       660
     tatgggaaag acgccagcac cattataaaa gcgattgtca ccggaaccct gatagccttc       720
     gttatctatg tgtgctggtt ggtggcgacc atggggaata tccctcgcaa tgattttgtc       780
     gatattattg cccagggtgg caatatgggg gtactggtta gcgccctatc cgatgtgatg       840
     agcagtggtt ggttaacgac catgctaacg gtttttgcta acctggcggt agcttcctct       900
     ttcttaggag ttaccttagg attattcgat tacctggccg atctctttgg tttcgatgag       960
     tctcgtagcg gtcgttttaa aacggcagcg gtaactttcc tgccaccgac ggtactgggg      1020
     ttgttgttcc ctaatggttt cctgattgca ataggttttg cggcactggc agcgactatc      1080
     tgggcggcga ttgtgccggc tatgatggcc tataaagccc ggaagctcta tccaaacagc      1140
     gagagcttta gggttcctgg tgggaccttt gtgattgcca tcgtcatttt gtttggtgtg      1200
     gtcaccggag cgtgtcatct gcttgcgatg gcagagttat tgcctgttta cggttag         1257
//

If you have problems or comments...

PBIL Back to PBIL home page