(data stored in ACNUC7421 zone)

EMBL: CP000821.PE206

CP000821.PE206       Location/Qualifiers
FT   CDS_pept        complement(234315..235505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0206"
FT                   /product="GGDEF domain"
FT                   /note="KEGG: sdn:Sden_0245 GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34819"
FT                   /db_xref="GOA:A8FPP6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPP6"
FT                   /protein_id="ABV34819.1"
FT                   /translation="MSAFYHRCRYFFLPLLVTAFSLGLLQFTQANWQIWQGSINQLPFW
FT                   LLVTATALALQFNRSRLAYLATLLLLFYADKQHHLLPSSLSSYTEANFLGGAMIITCFS
FT                   FFKDRGLLSPHSLVRVFSIFLCFGMAYGWLWGIEHFQAEITAKSPLSLSFQFQAALPLY
FT                   LCGLLVLTRTLWQANLVNTSILITFVIWVLYDLTPGQLPLSVLLSALAVIFLFTILIDS
FT                   YFLAYRDELTGLASRRALYNLVLSLGRKYSVAMLDIDHFKKFNDTYGHDVGDQVLKLVA
FT                   AKMARVSGGGKVFRYGGEEFTIVFPRKDTDSVIDHLEDVRESIEEYRIVLRDDKRKRST
FT                   KAKRNAANKSNKKTVSVTISIGVAERLGGETFDQTLKQADEALYRAKKKGRNQICT"
     ttgtctgctt tttatcacag gtgtcgctat ttctttcttc cgctgctagt cacagctttt        60
     tcattaggct tgcttcaatt tacacaagct aactggcaaa tttggcaggg gagcatcaac       120
     cagcttcctt tttggctact cgtcacagca accgcccttg cactacaatt taatcgtagt       180
     cgtttagcct atctcgctac actgctattg ctgttttatg ctgacaaaca acatcatctc       240
     ctcccctcat ctcttagctc gtacaccgaa gcgaactttt taggaggtgc gatgattatc       300
     acctgcttct ccttcttcaa agataggggg ctactctctc cccacagtct ggttagagtt       360
     ttttcaattt ttctctgctt tggcatggcc tacggctggc tatgggggat tgaacatttt       420
     caggcagaga tcactgctaa gtcacccttg agcctctcct ttcaatttca agcggctcta       480
     ccgctatact tatgtggact tctcgtttta acccgtaccc tatggcaagc aaatctggtc       540
     aacacctcga tactcatcac cttcgtcata tgggtgctgt atgatttaac ccccgggcag       600
     cttccacttt ccgtgcttct atcggcacta gcggtcatct tcctgtttac tatcttaatc       660
     gactcctact ttctcgctta ccgcgatgaa ctcacggggc tcgcatcgag acgagcactc       720
     tataatctag tgctatctct ggggagaaag tacagtgtag ccatgctcga tatcgatcac       780
     tttaagaagt ttaacgacac ctacggtcac gatgttggcg atcaggtgtt aaaactcgtt       840
     gccgctaaaa tggctcgcgt atccggtggc ggcaaagtat tcagatacgg cggtgaagag       900
     ttcaccatcg tttttccccg caaggacacg gactcggtta tcgatcacct cgaagatgtc       960
     agagagtcca tcgaggagta tcgaatagta ttacgggacg ataaacgcaa acgcagcacg      1020
     aaagcaaaac gtaacgctgc caacaaatca aacaagaaaa ccgtgagcgt caccatctcc      1080
     atcggggttg ccgagaggct gggaggcgag acgttcgatc agacgttgaa gcaagccgat      1140
     gaggccctct acagagccaa gaagaaagga cgcaaccaga tctgtacctg a               1191
//

If you have problems or comments...

PBIL Back to PBIL home page