(data stored in ACNUC7421 zone)

EMBL: CP000821.PE208

CP000821.PE208       Location/Qualifiers
FT   CDS_pept        236322..237110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0208"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="KEGG: slo:Shew_3533 glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34821"
FT                   /db_xref="GOA:A8FPP8"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPP8"
FT                   /protein_id="ABV34821.1"
FT                   /translation="MKVERYIQGQPCWIELASHDAKAGKQFYSELLGWGLQDMPIPDGV
FT                   YTMFNLALGEEIDEIGAAYQMHVETSEQGVPTNWTVYFAVDSVDTTIELVRTYGGELLL
FT                   GPHDVGTAGRMALLSDSEGAKFAIWQAGEHKGAGKRGEVGTLCWVELACRDSELAKQFY
FT                   PNILGWKAQPGDMPDFEYTEWLVDGQPFGSMMEMTEAWGDIAPHWMLYFTVADCDETAV
FT                   KAAKLGGKICVPPTTIPKVGRFAVINDPQGGFFSVIALNT"
     atgaaagtcg aacgatatat tcagggacag ccttgttgga ttgaactcgc cagtcacgat        60
     gcgaaagcgg gcaagcaatt ttatagtgaa ttgttaggct ggggtttgca ggatatgcct       120
     attccagacg gtgtatacac catgtttaat ctggctctcg gtgaggaaat cgatgagata       180
     ggtgctgcct atcagatgca tgtcgagacg agtgagcagg gagtgccaac gaactggacc       240
     gtctattttg ctgtcgatag cgtcgatacc accatagaat tagttagaac ctatggtggg       300
     gagttgttgc ttggccccca cgatgtcggc accgctggta gaatggcctt gctcagtgat       360
     tctgaagggg caaaatttgc gatatggcaa gcgggtgagc ataaaggggc tgggaaaaga       420
     ggagaggtcg gaacgctttg ctgggtggag ttagcgtgtc gggatagcga gctcgcaaaa       480
     cagttttacc ctaacatctt aggctggaag gcgcagccag gtgatatgcc cgactttgag       540
     tacaccgagt ggcttgtcga tgggcaacct tttggtagca tgatggagat gactgaggcg       600
     tggggagaca ttgcgcccca ttggatgctc tattttaccg tggccgattg cgatgaaaca       660
     gcggttaaag cagccaagct cgggggcaag atctgtgtac ctccgactac tatcccgaaa       720
     gtgggtcgct ttgccgttat caatgatcct cagggaggct ttttctctgt gattgctctc       780
     aatacctaa                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page