(data stored in ACNUC7421 zone)

EMBL: CP000821.PE21

CP000821.PE21        Location/Qualifiers
FT   CDS_pept        complement(25322..25789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0021"
FT                   /product="YbaK/EbsC protein"
FT                   /note="KEGG: slo:Shew_0016 YbaK/EbsC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34634"
FT                   /db_xref="GOA:A8FP61"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP61"
FT                   /protein_id="ABV34634.1"
FT                   /translation="MTPAIDLLKKAHIKHTIHEYQHEASALAYGIEAATKLNLDAKLVF
FT                   KTLVAKLDSGKLVVAIIPVEEKLNMKALAKVAGVKKAAMASAEEVERSTGYVLGGVSPL
FT                   GQKRPLLTYIDTSAEQLDQLYVSGGKRGLDIELTPSALLKLTRALFAPLIV"
     atgactcctg caattgacct cttaaaaaaa gcacacatca aacatactat tcatgaatac        60
     cagcatgaag ccagtgcact ggcctacggg attgaggctg cgacgaaact caatctcgat       120
     gcaaaactgg tatttaaaac tttggtggcc aaactcgaca gtggaaagct agtcgtagcg       180
     attattccgg ttgaagagaa acttaatatg aaagcacttg caaaggtagc tggagttaag       240
     aaggccgcca tggcctcggc tgaggaagtc gaacgttcta ccggttatgt attaggaggg       300
     gtgagtccct taggtcaaaa gcgtcctctg ttaacctata tcgatacctc ggcagagcaa       360
     ctcgaccagc tctacgtcag tggtggaaag cgtggcctgg atatagaact taccccctct       420
     gcactgttaa aactgacgag agcactgttt gcccccctca tcgtctag                    468
//

If you have problems or comments...

PBIL Back to PBIL home page