(data stored in ACNUC7421 zone)

EMBL: CP000821.PE211

CP000821.PE211       Location/Qualifiers
FT   CDS_pept        complement(242600..244552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0211"
FT                   /product="Membrane-fusion protein-like protein"
FT                   /note="KEGG: slo:Shew_3535 efflux transporter, RND family,
FT                   MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34824"
FT                   /db_xref="GOA:A8FPQ1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPQ1"
FT                   /protein_id="ABV34824.1"
FT                   /translation="MSHLESNNKRTKLAYLLSLFMVITPQLAHSQQLLAQENTAQHTEH
FT                   SHTDAKTATYSCPMHPDETSHEAGSRCSICNMFLVNEGVEEEEGRAKTSLSASEQKTYV
FT                   CPMHPDETSHEAGSRCSICNMFLVNEGVEEEEGGAKTNLSASEQKTYVCPMHPDETSHE
FT                   AGSRCSICNMFLVNEGVEEEEGGAKTSLTANEQKTYVCPMHPDETSHEAGSRCPICNMF
FT                   LVEEEEEEKGSVDHSSHNMSSSTPEDHSGHAHQTQEADTPADTVFNSAKPAPLDDGANI
FT                   KYVCPMHAHIISDVPGTCPICGMNLEKVELGGNSKEIQIDVSGGMQQALALKVARVEKD
FT                   TLWKFVQTVGQIDYDESKINHIHARVNGWIEKLTIESVGDKIIKGQLLYEIYSPDLINA
FT                   QDDFLLAQDTLKRSGSSENYKDLVRKAGLRLELLGFNKSQIKALAKSKKTQYRVPFYAK
FT                   SGGIVKALSVRDGMYIQPSTEVMSVVDLSKVWVIADVFENEQSWLEIGQKAEVSVPAMG
FT                   IKGIEGEIDYIYPELDAVTRSLRVRIVVKNKDLELRPNTLAKIDIFGGPNRDTLVIPQE
FT                   ALIQTGKENRVIVKLEDNSFTARKVTVGMLSQGKAEIKNGLEAGERVVTSGQFLLDSEA
FT                   SLKGSLMRLSSGHQH"
     atgagtcatt tagaatcgaa caataagcgc accaaattag cctatctgct tagcctgttt        60
     atggttatca ccccgcagtt agcccattca caacagctat tagctcagga gaatacagcc       120
     cagcatacag agcacagtca tacggatgca aaaacggcaa cttactcctg ccccatgcat       180
     cctgatgaga ccagtcatga agccggaagc cgctgctcta tctgtaacat gttcctcgtc       240
     aatgaaggag ttgaggaaga ggaaggcaga gccaagacga gcctaagtgc aagcgagcag       300
     aaaacctatg tgtgccccat gcatcctgat gagaccagtc atgaagccgg aagccgctgc       360
     tctatctgta acatgttcct cgtcaatgaa ggagttgagg aagaggaagg cggagccaag       420
     acgaacctaa gtgcaagcga gcagaaaacc tatgtgtgcc ccatgcatcc tgatgagacc       480
     agtcatgaag ccggaagccg ctgctctatc tgtaacatgt tcctcgtcaa tgaaggagtt       540
     gaggaagagg aaggcggagc caagactagc ctgactgcca atgagcagaa aacctatgtc       600
     tgccctatgc atccggacga gaccagtcat gaggcgggaa gccgctgtcc gatatgtaac       660
     atgttcctcg tcgaagagga ggaagaggag aaagggagcg tcgatcactc atctcataat       720
     atgagtagtt ctacccctga agaccactcg ggtcacgcac atcaaaccca agaggcagat       780
     acaccggcag atactgtctt caatagtgca aaaccagccc ctctcgatga tggggcaaat       840
     attaagtatg tctgtcctat gcatgcccat atcatcagcg atgtaccagg tacatgccct       900
     atctgtggta tgaacctgga aaaagttgag ttaggaggaa acagcaagga gatccagata       960
     gatgtttcag gcggcatgca acaggcatta gcccttaagg ttgccagagt cgaaaaagat      1020
     accctttgga agtttgtcca aaccgttggt cagatagatt atgacgagag caagataaat      1080
     catatccatg cacgtgtgaa tggctggata gagaagctca ccattgagtc tgtcggtgac      1140
     aaaattatca agggacaact gctatatgag atctactctc ccgatctgat caatgcccaa      1200
     gatgatttcc tgctcgcaca agatacctta aagcgctcag gaagcagcga gaactataaa      1260
     gacttagtga gaaaagccgg tttaagatta gaattgctcg gctttaacaa aagccagata      1320
     aaggctctgg ccaaatctaa gaaaacccaa tatcgagtcc cattttacgc taagagtggc      1380
     ggcatagtta aggcactatc tgtcagagac ggcatgtata tccaaccatc gacggaagtg      1440
     atgtctgtcg tcgacctgtc caaggtttgg gtcatcgccg atgtgtttga gaatgagcag      1500
     agctggcttg agataggcca gaaagccgaa gtctctgtac cagcgatggg tatcaaggga      1560
     attgaggggg aaattgacta tatctatccg gaactcgatg ccgttacccg tagcttaaga      1620
     gtcagaatcg tagtgaaaaa caaggatttg gaactgagac ctaatacgct ggctaagata      1680
     gacatatttg gtggtcccaa cagagacacc ttagtcattc cacaagaagc tctgattcag      1740
     acgggtaaag agaaccgcgt cattgttaag ctcgaagaca atagctttac cgcccgtaag      1800
     gtgacagtag gcatgcttag tcaaggcaaa gccgagataa aaaatggcct tgaagcggga      1860
     gagcgcgtgg tgacttcggg tcaatttctt ctcgactccg aagccagtct caagggtagt      1920
     ttgatgcgcc tcagcagcgg ccaccagcat taa                                   1953
//

If you have problems or comments...

PBIL Back to PBIL home page