(data stored in ACNUC7421 zone)

EMBL: CP000821.PE212

CP000821.PE212       Location/Qualifiers
FT   CDS_pept        complement(244575..245153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3536 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34825"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPQ2"
FT                   /protein_id="ABV34825.1"
FT                   /translation="MKTLLSLVLSVFILVSMVPAASAHQHEHAQHESADYACPMHPEVT
FT                   GQKGDSCPKCGMNLEANKATTSKHQGKKCDSCPNHKAKAHKDMHADTHACPMHPSVTGE
FT                   KGDTCPDCGMNLTASKAASQHHGKKCDSCPNHGAKAHKDMHADTHACPMNPKITGKKGD
FT                   TCPKCGMNLEPIKTAANGAGKHPAHHKQQ"
     atgaaaacct tgttaagcct agttttatca gtctttattc tagtttcaat ggtgccggca        60
     gcttctgcac atcagcacga acatgcacaa catgaaagtg ccgattatgc atgccctatg       120
     cacccggaag ttaccggaca gaagggtgat agctgcccaa aatgcggtat gaatttagaa       180
     gcaaataagg ctactacctc taaacatcag gggaaaaaat gtgactcttg ccctaaccat       240
     aaagcgaaag cacataagga tatgcatgca gatacccatg cctgtccaat gcacccaagt       300
     gttaccggag aaaagggcga tacttgccct gattgcggta tgaacttaac cgcctctaaa       360
     gcagcttccc aacatcatgg aaaaaaatgc gattcttgcc ctaatcacgg agcaaaagcg       420
     cataaggata tgcatgctga cactcatgcc tgccctatga atccaaagat cacaggaaaa       480
     aagggtgata cctgccctaa atgtggaatg aacttagagc caatcaaaac ggcggctaac       540
     ggagcaggga aacacccagc tcaccacaag cagcaataa                              579
//

If you have problems or comments...

PBIL Back to PBIL home page