(data stored in ACNUC7421 zone)

EMBL: CP000821.PE213

CP000821.PE213       Location/Qualifiers
FT   CDS_pept        complement(245418..245819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0213"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3537 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34826"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPQ3"
FT                   /protein_id="ABV34826.1"
FT                   /translation="MALLAMLSQGLMTNGFSMVRNAEAHEAMMSESHDSDMMSMGDGAN
FT                   CHSEQTSNTDHCCDNEQNEVLPGTAQNCCDGDGFCQGNCSHCLVISVTGTLFYAKSWPG
FT                   FSPSQLSMATQMPYFHSISLTTDLRPPIA"
     ttggccttgc tcgcaatgtt gagccagggc ctgatgacta atggtttttc gatggtaaga        60
     aatgctgaag cacatgaagc tatgatgtct gaatcacacg attcagacat gatgagtatg       120
     ggagatggag ctaactgcca ctcagaacag acaagcaaca ctgaccattg ctgcgataat       180
     gagcagaacg aggtgcttcc cggcactgct cagaactgct gtgacggcga cggattttgc       240
     cagggtaatt gtagccactg tcttgttatc tctgtgactg gtactctatt ttacgctaaa       300
     tcttggcctg gatttagtcc ttcccaactt tcaatggcca ctcaaatgcc ttatttccac       360
     tctatctcgt taacgacaga tctcagacct cctatagctt ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page