(data stored in ACNUC7421 zone)

EMBL: CP000821.PE214

CP000821.PE214       Location/Qualifiers
FT   CDS_pept        complement(245985..246410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0214"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_0591 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34827"
FT                   /db_xref="InterPro:IPR018635"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPQ4"
FT                   /protein_id="ABV34827.1"
FT                   /translation="MKTLITAVALTLASFTSIAASVSFPDSLVVTGINGEKRFDAHQPQ
FT                   LADGENLIQLRYHDIFEVNADDSGAWVKSEPLYLLVDFQGQQEYQAATPTINTEDEAYD
FT                   FIENPIITLEDAQGKNKTVALLTHQQLMAKVLLTRKN"
     atgaaaacat taattacagc tgttgcactt acccttgcaa gttttacctc tatcgctgcg        60
     agcgtctctt ttcctgactc gctggtcgtt acaggcatta atggagaaaa gagatttgat       120
     gctcatcaac ctcagctagc agacggagag aatttaattc aacttagata tcacgatatt       180
     tttgaggtca atgcggatga ctcaggcgca tgggtaaaat ctgagcctct gtacctttta       240
     gtcgacttcc agggtcaaca agagtaccaa gctgccacgc cgactattaa cactgaagat       300
     gaagcctatg atttcatcga aaatccgatt attacacttg aagatgctca gggtaaaaac       360
     aaaacagtgg ccctgctcac tcatcaacag ctgatggcca aagtgttatt gacacgaaaa       420
     aactag                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page