(data stored in ACNUC7421 zone)

EMBL: CP000821.PE215

CP000821.PE215       Location/Qualifiers
FT   CDS_pept        complement(246604..247095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0215"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3539 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34828"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPQ5"
FT                   /protein_id="ABV34828.1"
FT                   /translation="MVLIISLVGQFLLSPAMAMPSLLHAFSHSQMSLLSNSELSESELS
FT                   DSELMPAEAMTVVTNQTQPNNNLPANEDQAMTHGQQDCDMAMSGLSNHDGPTIDCDALC
FT                   EMMGAGNCASHCTSATGILTQPQISLISPETSGRVQSGSWSTQTVELSSSNPPPKFEQA
FT                   "
     ttggtattaa tcatctctct ggtagggcaa tttttgcttt caccagcgat ggctatgccg        60
     agtttgttac atgctttctc tcactctcag atgtcattac tttctaactc agagctttct       120
     gaatccgagc tctctgactc tgaactcatg cctgcagagg ctatgactgt tgttacaaat       180
     caaacgcagc cgaataataa tcttcccgcg aacgaagacc aagccatgac acatggccag       240
     caagactgtg atatggcgat gtcaggttta agcaatcatg atggcccgac tatcgattgt       300
     gatgcgttat gtgaaatgat gggagccggc aactgtgcct ctcactgcac ttcagcaaca       360
     ggcatcttaa ctcaacctca gattagccta atatcgccag aaacaagcgg tagagtgcaa       420
     tcaggctcat ggtcaaccca gactgtcgag ctatcatcat ctaatcctcc tcccaaattt       480
     gagcaagctt aa                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page