(data stored in ACNUC7421 zone)

EMBL: CP000821.PE217

CP000821.PE217       Location/Qualifiers
FT   CDS_pept        complement(248722..249012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0217"
FT                   /product="protein of unknown function DUF1145"
FT                   /note="KEGG: shn:Shewana3_3974 protein of unknown function
FT                   DUF1145"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34830"
FT                   /db_xref="GOA:A8FPQ7"
FT                   /db_xref="InterPro:IPR009525"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPQ7"
FT                   /protein_id="ABV34830.1"
FT                   /translation="MKFVITTGKAVTLFAWLLMTYNLIMPFEGNIAIILYILLAITTFM
FT                   HCFQVVIFHTIFKSLLSLKKGDYFSVFIFGAFSLLQYRSKVMQNLGNAETR"
     atgaaatttg taattactac aggtaaggct gtcaccctat ttgcctggct tttgatgaca        60
     tacaacctga tcatgccatt tgaaggcaat attgccatca ttctatatat actgctggca       120
     atcaccacat ttatgcactg ttttcaggtc gttatattcc acaccatatt caaatcacta       180
     ctctctttaa agaaaggtga ctacttcagt gtctttatat ttggggcatt tagcctgttg       240
     caatatagaa gtaaggtaat gcagaactta ggtaatgcgg agaccaggta a                291
//

If you have problems or comments...

PBIL Back to PBIL home page