(data stored in ACNUC7421 zone)

EMBL: CP000821.PE219

CP000821.PE219       Location/Qualifiers
FT   CDS_pept        250086..251708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0219"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="KEGG: slo:Shew_3606 signal recognition
FT                   particle-docking protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34832"
FT                   /db_xref="GOA:A8FPQ9"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPQ9"
FT                   /protein_id="ABV34832.1"
FT                   /translation="MAKKGFFSWFRKDKSKDEVSAPEAEVVTESQDAVEAEALSEEQAK
FT                   QAEQARIEAEALALAEEQAEQARIEAEALALAEEQAKQAELARIEAEALALAEEQAKQA
FT                   EQARIEAEAAALAEEQAKQAEQARIEAEAAALAEEQAKQAEQARIEAEAAALAEEQAKQ
FT                   AELARIEAEAAALAEEQAKQAEQARIETEAAALAEEQAKQAELDAEQVAAEQETEKQPE
FT                   PQEKPTKEGFFARLKRGLKRTSENIGSGFVSLFSGKKIDDDLFEELEEQLLIADVGVET
FT                   TTRLIDSLTEQASRKQLKDGEALYEILRDEMQKTLEPVSIPLVPESADGPFVILMVGVN
FT                   GVGKTTTIGKLAKQYQAQGKSVMLAAGDTFRAAAVEQLQVWGQRNDIPVVAQHTGADSA
FT                   SVLFDALQAARARNIDILIADTAGRLQNKAHLMDELKKVIRVMKKQDESAPHEVMLTLD
FT                   ASTGQNAISQAELFKKAVGVTGITISKLDGTAKGGVIFAIADKFGIPIRHIGVGEQIDD
FT                   LRTFDAKDFVDALFTQESDENKS"
     atggcaaaga aaggtttttt ttcctggttt cgcaaagata agtcgaaaga tgaagttagt        60
     gcgccagaag cagaagttgt aactgaatca caagatgctg tcgaagctga ggcgctttcc       120
     gaagaacagg ctaagcaagc cgagcaggca cgtatcgagg ctgaagctct agcacttgcc       180
     gaagagcagg ccgagcaggc tcgtatcgag gcagaagctc tggcacttgc cgaagagcag       240
     gctaagcaag ccgagctggc acgtattgag gctgaagctc tcgcacttgc cgaagagcag       300
     gctaagcaag ccgagcaggc acgtatcgag gctgaagctg cagcacttgc cgaagagcag       360
     gctaagcaag ccgagcaggc acgtatcgag gctgaagctg cagcacttgc cgaagagcag       420
     gctaagcaag ccgagcaggc acgtatcgag gcagaagctg cggcattggc cgaagagcaa       480
     gctaagcaag ccgagctggc acgtatcgag gcagaggctg cggcattggc cgaagagcaa       540
     gctaagcaag ccgagcaggc acgtatcgag acagaggctg cggcacttgc cgaagagcag       600
     gcaaagcaag ccgagctgga cgctgaacaa gtggcggcag agcaagaaac cgaaaaacaa       660
     ccagagcctc aggaaaaacc caccaaagag ggctttttcg ctcgccttaa gcgaggtctt       720
     aaacgcacga gtgaaaatat cggtagcggg ttcgttagcc tgtttagcgg taagaagatc       780
     gatgatgatc ttttcgaaga gcttgaagaa cagttgctta ttgcggatgt cggtgttgaa       840
     acaacaacac ggttaatcga tagtctgacc gagcaagcta gtcgtaaaca gttaaaagat       900
     ggtgaagctt tatatgaaat tttgcgtgat gagatgcaaa agacattaga gcctgtctca       960
     atcccactcg ttcctgaaag tgccgacgga ccttttgtta tcctgatggt cggtgtgaat      1020
     ggggtcggaa aaacgacgac aattggtaaa ctggctaagc aatatcaggc gcaaggtaag      1080
     tccgtaatgc tggctgccgg tgataccttc cgtgcggctg cggttgagca gttacaggtg      1140
     tggggacagc gaaatgacat tcctgtcgtg gcacaacata ctggtgccga tagtgcatcg      1200
     gtgttgtttg atgcacttca ggcggctcgt gctcgtaata ttgatatttt gatcgccgat      1260
     accgcgggtc gacttcagaa taaggcacat ctgatggatg agctgaagaa ggttatccga      1320
     gtgatgaaga agcaagatga gtccgcgccc catgaggtta tgttgacctt agatgcgagc      1380
     actggccaaa atgcaattag tcaggcagag ttatttaaaa aagcggttgg tgttaccggc      1440
     atcacaatca gtaagcttga tggtactgct aaaggcggtg tgatttttgc tattgccgat      1500
     aagttcggta ttcctatccg tcatatcggt gtcggtgagc agatcgatga tctacgcacc      1560
     ttcgatgcca aagattttgt cgatgcgctt tttactcaag agagtgatga gaataagtcg      1620
     tag                                                                    1623
//

If you have problems or comments...

PBIL Back to PBIL home page