(data stored in ACNUC7421 zone)

EMBL: CP000821.PE220

CP000821.PE220       Location/Qualifiers
FT   CDS_pept        251738..252430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0220"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="KEGG: slo:Shew_3605 cell division ATP-binding
FT                   protein FtsE"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34833"
FT                   /db_xref="GOA:A8FPR0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPR0"
FT                   /protein_id="ABV34833.1"
FT                   /translation="MIRFEQVSKVYPGGQKALSDVNFHLKRGEMAFLTGHSGAGKSTLL
FT                   KLITVIERANAGRVLINGHDIAKLSRSDVPFLRRDIGMIFQSHHLLMEKSVFDNVALPL
FT                   VIEGFSHGEIKKRVLAALDMVGLYGKERHSPIMLSGGEQQRVGIARAIVNKPPLLLADE
FT                   PTGNLDPKLSMDILRLFETFNDSGTTVLIATHDLGLIARMKYRTLTLKQGHVLGGEELM
FT                   SSADGVKG"
     atgattcgat ttgagcaggt aagtaaggtt tatcctggtg ggcagaaagc cttgtcagat        60
     gttaactttc acctaaagcg cggcgagatg gcctttttaa cgggtcactc cggcgcaggt       120
     aaaagtacat tgcttaaatt aatcacagtg atcgaacgcg ctaatgccgg gcgtgtgtta       180
     attaacggac atgatattgc aaagctttca cgctcggatg ttccattttt aaggcgtgac       240
     attgggatga ttttccagag tcatcatctg ttgatggaaa agagtgtttt cgataatgtc       300
     gccctgcctt tggtgatcga aggtttttcc catggtgaga taaaaaaaag ggtcttggcc       360
     gcattggata tggtgggact ctatggcaaa gagcgccata gtcccatcat gttgtctggt       420
     ggtgaacagc agcgtgtggg cattgcacgt gcaatcgtta ataagccgcc gttattgttg       480
     gccgatgaac ctacgggtaa cttagatcct aagttgtcta tggatatcct acggttattt       540
     gaaaccttta atgactcagg caccacagta ctgattgcga cccatgattt gggacttatc       600
     gcacgcatga aatatcgtac actgactttg aaacagggac atgtgctggg tggcgaagag       660
     ctgatgtctt cggctgatgg ggtaaaggga taa                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page