(data stored in ACNUC7421 zone)

EMBL: CP000821.PE221

CP000821.PE221       Location/Qualifiers
FT   CDS_pept        252433..253398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0221"
FT                   /product="protein of unknown function DUF214"
FT                   /note="KEGG: slo:Shew_3604 protein of unknown function
FT                   DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34834"
FT                   /db_xref="GOA:A8FPR1"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPR1"
FT                   /protein_id="ABV34834.1"
FT                   /translation="MSNKPQLTRSKLPISGRIVMFFIRHIQHAMGSMGELWRNPVSSLM
FT                   TMAVLGVSLSLPAALQVLVKNAETITQSWNSAAEISLFVDEGRSERTIQSLITRIKVYP
FT                   EVSEVNYINRAQALEEFQRLSGFGEALSYLDTNPLPAVVTVTPSLKYSSPVGARELLKK
FT                   LEMEPEVSFGRLDIEWLERLQAVVRLLERTVLAIAALLVLAVVLVIGNTIRLAIMNRRT
FT                   EIEVMKLVGATEAFIQRPFLYTGIWYGIIGGVLAWIIINLLVWYLDSALAELLGLYGSQ
FT                   LEMQSLTLVELGQLVGLASFLGWLGSYLSVRQHLRAIEPS"
     atgagcaata aacctcagtt aaccagaagc aaattgccta tttcgggtcg tattgtgatg        60
     ttctttattc gtcatatcca acacgctatg ggcagtatgg gtgagttgtg gcgtaacccg       120
     gtatcctctc ttatgaccat ggccgtgctt ggggttagct tgagcctacc tgcagcgctg       180
     caggtactgg ttaagaatgc agagaccatc acccaatcat ggaatagcgc ggctgaaatt       240
     tcactttttg ttgatgaagg acgaagtgaa agaacgattc agagcttgat cactcgcatt       300
     aaagtttacc ctgaagtgag cgaggttaac tatattaacc gggctcaggc cctcgaagag       360
     tttcaacgct tatccgggtt tggcgaagct ctttcctatt tagatactaa tccgctccct       420
     gcggtcgtca cagtgactcc aagccttaaa tattcaagcc cggtcggggc gcgcgaatta       480
     cttaagaaac tggaaatgga acccgaagtc agttttggtc gactcgatat cgagtggttg       540
     gagcgacttc aggcggtcgt gaggctactg gagcgaacgg tactcgccat tgcggcactc       600
     ttagtgttag cggtggtact ggtgataggc aatacgattc gcttagctat catgaatcgc       660
     cgcaccgaga tcgaggtgat gaaactcgtc ggtgcgaccg aagcctttat tcagagaccc       720
     ttcctctata ccgggatctg gtatggaata ataggtggtg ttctggcatg gataatcatt       780
     aacctgttag tctggtatct cgatagcgca ttggccgaat tgctgggctt gtatgggagt       840
     cagttagaga tgcagtcttt gactctcgta gagcttggtc agttagtcgg cctggcctca       900
     tttctaggtt ggctgggatc ttacctctcg gtacgtcaac acctcagggc gatagagcct       960
     tcatga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page