(data stored in ACNUC7421 zone)

EMBL: CP000821.PE222

CP000821.PE222       Location/Qualifiers
FT   CDS_pept        253663..254520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0222"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="KEGG: slo:Shew_3603 RNA polymerase, sigma 32
FT                   subunit, RpoH"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34835"
FT                   /db_xref="GOA:A8FPR2"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPR2"
FT                   /protein_id="ABV34835.1"
FT                   /translation="MTNQTQSMALTVPHGSGSLEAYVHSAHNISMLQPEQEYELAKRLQ
FT                   ETGDLQAAKQLIMSHLRFVVHVAKGYSGYGLPQADLIQEGNIGLMKAVKRFDPNVGVRL
FT                   VSFAVHWIKAEIHEYVLKNWRIVKVATTKAQRKLFFNLRKSKKRLGWFSDEEVGMVADN
FT                   LGVSKADVTEMESRMAAQDPAFDLASDNDDDHDFAPMHYLEDHSSDLASQVENDNLEAS
FT                   NQARLLSAIKTLDERSQHILQARWLNEDKTTLQELAATYQVSAERIRQLEKNAMNKLKG
FT                   RMEA"
     atgactaatc aaacgcaatc aatggcactg actgttcccc acggaagcgg tagcctggaa        60
     gcttatgttc actcggccca caacatctcg atgttgcagc cagagcaaga gtatgagtta       120
     gccaagcgtt tgcaagaaac gggagaccta caggctgcga agcagctgat tatgtctcac       180
     ctgcgttttg tcgtgcacgt tgctaaaggg tattccggtt acggcttacc acaagcggac       240
     cttatccagg aaggcaatat tggtttgatg aaggccgtaa aacgcttcga tcccaatgtc       300
     ggtgtccgcc ttgtctcttt tgctgttcac tggattaaag ctgaaattca tgaatatgtg       360
     cttaaaaact ggcgcatagt caaagtcgct accactaaag cgcaacgtaa actctttttt       420
     aacctgcgta aatctaaaaa acgtctgggt tggttcagcg atgaagaggt cggtatggtt       480
     gccgataatc tgggtgtttc taaagccgat gtgaccgaaa tggagtcacg catggcagct       540
     caggatcccg ctttcgatct tgccagtgat aacgatgacg atcacgattt tgcgcctatg       600
     cattatctgg aagatcattc gtcggattta gcatctcaag ttgaaaatga taatttagaa       660
     gcgagtaatc aggcccgcct tctgtccgct atcaagacgt tggatgagcg tagtcagcat       720
     attctgcagg cgcgttggtt aaatgaagat aagacgacac tgcaagagct tgctgcaact       780
     taccaggtat cagccgagcg aatcaggcag ctggaaaaga atgccatgaa taagctgaaa       840
     ggccgaatgg aagcctaa                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page