(data stored in ACNUC7421 zone)

EMBL: CP000821.PE227

CP000821.PE227       Location/Qualifiers
FT   CDS_pept        260780..261730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0227"
FT                   /product="cytochrome c family protein"
FT                   /note="KEGG: sfr:Sfri_3686 cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34840"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR020015"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPR7"
FT                   /protein_id="ABV34840.1"
FT                   /translation="MIYRVFYNLLCGVITVLCLSLSAHAVPWQNLTGEQLEQKLAEKFS
FT                   AGEYSSKGADSCLMCHRKDEAVMAIFDGTHGMMNSKQSPMAGLQCEACHGPQGKHNRGG
FT                   KEPMIAFGTDSKLSASAQNSVCQGCHNDPKQMAWHSSTHNLEEVACADCHTLHSAKDPA
FT                   LDKLSVNDTCSSCHTKEKADMNKRSSHPLKWDQMTCIDCHSPHGSMSESALNKPTINDT
FT                   CYSCHSEKRGPVLWEHAPVTENCVTCHNPHGSVNEGMLKSRAPQLCQQCHAPDGHASRV
FT                   VQEPGMDAFGGGKSCLNCHSKIHGSNHPSGSLLQR"
     atgatttatc gcgttttcta caacttatta tgtggggtga tcactgtctt gtgtttatcc        60
     ctaagtgcac atgccgttcc ctggcaaaat ctcaccggtg aacaacttga acaaaagtta       120
     gctgaaaaat tctcggctgg tgaatactca tcgaaaggcg ccgactcctg cttgatgtgt       180
     caccgtaaag atgaagccgt gatggctatt ttcgatggta cccacggcat gatgaacagt       240
     aagcagtcgc caatggcggg cctgcaatgt gaagcctgtc atggtcctca agggaagcat       300
     aacaggggcg gcaaggagcc gatgatcgcc ttcggtacag acagcaagct gtcggcctcc       360
     gcgcaaaaca gtgtttgtca ggggtgtcat aacgacccta aacagatggc gtggcacagc       420
     agtacccata accttgaaga ggtggcatgt gccgactgtc atactctgca cagcgccaaa       480
     gaccccgctc tggacaagct cagtgtgaat gacacctgta gctcgtgcca taccaaagaa       540
     aaagccgata tgaataagcg ctcatctcat cctttgaaat gggaccagat gacctgtatc       600
     gattgtcact ctcctcatgg ttctatgagt gaaagcgctc tgaataagcc gacgattaat       660
     gacacctgct attcatgtca cagtgaaaaa cgtggtccgg ttttgtggga acacgcaccg       720
     gtcacagaga actgtgtcac ctgtcataac cctcatggca gcgtcaatga aggcatgctg       780
     aaaagccgtg cgcctcaact ctgtcaacag tgtcatgcac ccgacggtca tgccagtcga       840
     gtggtgcagg aaccgggaat ggatgccttc ggcggtggta agagttgctt gaattgtcac       900
     agcaagatcc acggttctaa ccatccgtca ggcagcttgc tgcagcgtta a                951
//

If you have problems or comments...

PBIL Back to PBIL home page