(data stored in ACNUC7421 zone)

EMBL: CP000821.PE228

CP000821.PE228       Location/Qualifiers
FT   CDS_pept        261745..263754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0228"
FT                   /product="outer membrane protein"
FT                   /note="KEGG: sfr:Sfri_3685 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34841"
FT                   /db_xref="InterPro:IPR020016"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPR8"
FT                   /protein_id="ABV34841.1"
FT                   /translation="MGFKLNIITVSLLAVSGSAMATNFGVGNANTDSINMDKYQCKRCV
FT                   STNGYIGEVSVSAGYNSVDDIHAGNALGSAEDGAIAAVSGDIRYQNETGYRAQIQAHQL
FT                   GMDNGFANIKVGKSGLYELELDYQSLKSYQAGDVQSQLWHDDGMLTPSSYTNEFDLALK
FT                   REKSAIGFNYGEGFYNTFIRYSQEEKTGHQSSSLVAPSPVNFGLPVDATTKQLDAGASL
FT                   AGDNWLTELSYFGSYYGNNIKDLSLPHMNDVYSATPDNEAHQVSLSGQYQFNRTVMSGR
FT                   LVTGRMIQDDALIQMSGNPLQSWDGQIDTLDGRFAVTSMLSNRLRLGGSVDYSKRDNKS
FT                   SVWEFTQYSYNGLSGSFKQNVPQDIERNTYKVNASYRIASGYRLQAGYDRKEVDRSYSE
FT                   REQTNEDSLWAKFNVSAFDTFKVNLKASHGNRGGSDYEVDEVTSSQENALMRKYYLADR
FT                   KRNAVELKVNHSPLSWMSIDVTGRYAKDDYDATEIGLTESEDFGYDVNLSLQFSKHLSA
FT                   YGFAGQQWINSAQAGSQSFSSPDWNADIEDEFINIGAGFSYGGLMQDKLTLGGDYLFSN
FT                   SISDTSVGGTLVTTNGSQPYGDYFSYNHSVRMYADYALSKQMALKLSYQYERYYDTDAA
FT                   QVATNAVPGLTTLGELNHDYNAHEVMLSFSYLLR"
     atgggattta aactcaatat catcacggtg tcgctcctgg ctgtttctgg ctcggcgatg        60
     gctacaaact tcggtgtcgg taacgccaat actgactcga tcaatatgga taagtaccag       120
     tgcaaacgtt gtgtctcgac caatggatat attggtgagg tctcagtctc ggcgggttac       180
     aactcagtgg acgatatcca tgcggggaac gcgctgggaa gtgccgaaga tggcgccatc       240
     gccgccgtga gtggtgatat ccgttatcaa aatgagaccg ggtaccgggc acaaattcaa       300
     gctcaccagt tgggcatgga taatggcttt gccaatatca aggtgggaaa gtctggcctc       360
     tacgagctgg agctggatta tcaatcgctt aagagttatc aggcgggcga tgtgcagagt       420
     cagctttggc atgacgatgg gatgttaacc cccagcagct acaccaatga gtttgatctg       480
     gcgctaaagc gcgagaagtc ggcgataggc ttcaattatg gagaggggtt ttataacacc       540
     ttcatccgct atagtcagga agagaaaacg ggtcatcaat cgagcagcct ggtcgcgcca       600
     agtccggtca acttcggttt gcctgtcgat gctaccacta agcagctcga tgcaggcgca       660
     tcgttagccg gcgataactg gttaactgag ttgagctatt tcggtagtta ttacggcaat       720
     aacatcaaag acctgagcct gcctcatatg aatgatgtct attctgcaac gccggataat       780
     gaggctcatc aggtgtcact ctcgggtcag taccagttta atcgtaccgt gatgagtggc       840
     cgtctcgtga cgggacgaat gatccaggat gacgcgctta tccagatgag tggtaatccg       900
     ctgcaaagct gggatgggca gatagatacc ttagatggtc gttttgcggt gacctccatg       960
     ttgagcaatc gcctgcgttt aggtggtagc gtcgattaca gcaaacgcga taacaagagc      1020
     tctgtgtggg aatttaccca gtacagttac aacggcttaa gcggctcatt taagcaaaat      1080
     gtgccccagg atatcgagcg caacacctat aaggtcaatg ccagttaccg cattgccagt      1140
     ggttaccgtc tgcaagccgg ttatgacagg aaagaggtcg accgtagcta tagcgaacgt      1200
     gagcagacca atgaagatag cctgtgggcc aaatttaatg tgagtgcctt cgacacgttc      1260
     aaggtcaatc ttaaagccag ccacggcaat cgaggtggtt cggattatga agttgacgag      1320
     gtcacctctt cacaagagaa cgccttgatg cgcaagtact atcttgcgga tcgtaaacgt      1380
     aatgccgttg agcttaaggt taatcactcg cctctgtcct ggatgagtat cgatgttacc      1440
     gggcgttatg ccaaagacga ctatgacgcc accgagatag gcctgacaga atcggaagac      1500
     ttcggctatg acgtcaatct gagcctgcag ttcagtaagc atctgtcggc ctacggtttt      1560
     gctggtcagc agtggattaa ctcggcacaa gccggtagcc agagtttcag tagcccggac      1620
     tggaacgccg atatcgaaga tgagtttatc aatatcggtg ccggttttag ctatggcggt      1680
     ctgatgcagg acaaactcac cttaggcggt gattacctgt tcagtaattc aatcagtgac      1740
     acctcggtcg gggggaccct ggttacgacc aatggtagcc agccatacgg tgattacttc      1800
     tcctataacc acagcgtgcg tatgtatgcc gattatgcct tgagcaaaca gatggcattg      1860
     aagctgagtt atcaatatga acgttattac gacacagatg cggctcaagt cgcgacgaat      1920
     gctgtgccgg ggctaaccac gttaggtgag cttaaccatg actataacgc gcacgaagtg      1980
     atgttgtcgt ttagctattt gttgcgctaa                                       2010
//

If you have problems or comments...

PBIL Back to PBIL home page