(data stored in ACNUC7421 zone)

EMBL: CP000821.PE229

CP000821.PE229       Location/Qualifiers
FT   CDS_pept        263789..266305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0229"
FT                   /product="anaerobic dimethyl sulfoxide reductase, A
FT                   subunit, DmsA/YnfE family"
FT                   /note="KEGG: spc:Sputcn32_0627 anaerobic dimethyl sulfoxide
FT                   reductase, A subunit, DmsA/YnfE family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34842"
FT                   /db_xref="GOA:A8FPR9"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR011888"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPR9"
FT                   /protein_id="ABV34842.1"
FT                   /translation="MERRSFLKMSAAMGCAASVTGCKTSSDDANVVPPQPPVGEEQITW
FT                   SSCLVNCGSNCPVKVFSRDGVITRVETDHDVADGDDVYQVRACARGRSLRQRTYAVDRL
FT                   KTPMKRVGKRGEGKFVPISWDEAAKTIGTKLTSVIAEHGNKAIFRSYGSGAYYGFASNA
FT                   CFNRLFNLNGGCLNAYGNYSWAQQMEAAKHTFGTGSTSGSSTVTLANSDFLLGVAYNPS
FT                   EIRQSGSGEGYDYLKALQKSNGLKVVMIDPRYTDSMLGKESKWLPIRPGTDAAFAEAIA
FT                   YQMISSGWVDQNSLSFINKYAVGFDAASITAQKELFANSGDATKQEYAKVMKPEENYRD
FT                   YILSQGVYADQPLKTSEWAEKITGIPAAQLEQIATDLQNAKAPYIVVGAGVNRQANGEQ
FT                   SMRALYMLSVLTGKLGTLGASNGELPSMSGMYRAGIPTGSNPVKESISFFTWSEAIHNG
FT                   ETMTARSHGVRGTDGLDTPLGTNIKVIISASDSSLLNQHAEINNTAKILEDETGVELIV
FT                   SCDCWMTPGAKFADIILPDTSWLESNDLVNDSYASGALGYITAMKSAIEPMWDCKSMYE
FT                   ASALIAKYMGCEAEFTEGKTEEQWLEELYQKTKDSSTNLGVVPAFPATYKEAQEIGFFR
FT                   KNMNDNHVALKSYINGGKALSTPSGKIEIYSAELAWRAANWDQELTTDVKGDTITAIPQ
FT                   YTVTWDGYEDEDTSTDYPIQLAGYHTKGRTHSSYHNVPWLREAVEDAVWVNPMDAAENG
FT                   LSAGDKIEMYNERGSIAVKVRITPRVAPGVFALGQGAWFKPGNTVGSTGHIIDEGGAIN
FT                   TLTRYQPSPVAKGNPQHTNRVAIKKI"
     atggaacgca gaagtttctt aaaaatgagt gcagccatgg gttgtgcagc aagcgtaaca        60
     ggttgtaaaa ccagttcaga tgatgccaat gttgtaccac cacagccacc tgtcggtgaa       120
     gagcaaataa cctggtcatc ttgtctggtt aactgtggct ctaactgccc ggttaaagtg       180
     tttagccgtg atggtgttat tacacgcgtt gaaaccgatc acgacgttgc cgatggcgat       240
     gatgtttacc aagtgcgcgc ctgtgcccgt ggtcgttcac tacgccagcg cacctatgcc       300
     gtcgatcgct taaaaacacc gatgaagcgt gttggtaagc gtggtgaagg taagtttgtg       360
     cctatcagct gggatgaagc ggcaaaaact atcggtacta agctaacgtc tgtgattgcc       420
     gagcatggca acaaggctat cttccgtagc tatggctctg gggcttacta tggtttcgct       480
     tctaacgcct gttttaaccg tctgtttaac ttaaacggtg gctgcctgaa tgcctatggt       540
     aactactctt gggcacagca gatggaagcg gctaagcata ccttcggtac cggtagtact       600
     tcggggtcat cgacggtgac tctggcaaac agtgacttcc tgttgggtgt ggcttataac       660
     ccaagcgaaa ttcgtcagtc gggttcgggt gaaggttatg actacctgaa ggcactgcaa       720
     aagagcaacg gcctgaaagt cgtgatgatc gatcctcgct acactgactc tatgttaggt       780
     aaagagtcta agtggttgcc tatccgcccg ggtaccgatg cggcctttgc tgaagccatc       840
     gcttatcaga tgatcagctc tggttgggtc gaccagaact cactcagctt tatcaacaag       900
     tatgccgtag gtttcgacgc tgcctctatt actgcgcaaa aagaactttt tgcaaatagc       960
     ggcgatgcca ccaagcaaga atacgctaag gtgatgaagc cggaggaaaa ctaccgtgat      1020
     tacatcttaa gccagggcgt ctacgccgat cagccgttga agacgtctga gtgggccgaa      1080
     aaaattaccg gtattccggc tgcgcagctt gagcaaattg cgaccgacct acaaaatgct      1140
     aaagccccct atatcgtcgt tggcgccggt gttaaccgtc aggccaatgg tgaacaaagc      1200
     atgcgcgcgc tttacatgct atctgtattg acgggtaagt tgggtacctt aggtgcatcg      1260
     aacggtgaac tgccatccat gagcggaatg taccgcgccg gtattccaac gggtagcaac      1320
     ccggttaaag aaagcatctc attctttacc tggtctgaag ctattcataa cggcgaaacc      1380
     atgactgcac gcagccacgg cgttcgtggt accgacggtt tggacacgcc actgggcacc      1440
     aatatcaagg tcatcatctc tgcgtcagac agctcgctgc tgaaccaaca tgccgagatc      1500
     aacaacaccg ctaagatctt agaagatgaa acgggtgttg agctgattgt cagctgtgat      1560
     tgctggatga ctccaggggc taagtttgcc gatatcatct tgcccgatac cagctggtta      1620
     gaatcaaatg acttagttaa cgacagctat gcctccggtg cactgggtta catcacggcg      1680
     atgaagtcgg cgattgaacc tatgtgggac tgtaagtcta tgtatgaagc atcagcactg      1740
     attgctaagt acatgggttg tgaagctgaa ttcaccgaag gtaaaactga agagcagtgg      1800
     ctcgaagagt tataccagaa gaccaaagac agcagcacta acttaggcgt cgtgccagcc      1860
     ttcccggcga cttacaaaga agcacaagag attggcttct tccgtaaaaa catgaacgac      1920
     aaccatgttg cgcttaaaag ttatatcaat ggcggtaaag cactgtcgac cccaagtggc      1980
     aagattgaga tctactctgc cgagcttgca tggcgagcag ctaactggga tcaagagctt      2040
     acgactgacg ttaagggtga caccatcaca gcaattcctc agtacacagt gacttgggat      2100
     ggttatgaag atgaagacac cagcactgat tacccaattc agttagcggg ttaccacacc      2160
     aagggtcgta ctcactcaag ctatcacaac gtgccttggc ttcgtgaagc ggttgaagat      2220
     gcggtttggg tgaacccaat ggatgctgca gagaacggtc tgagcgctgg cgataagatt      2280
     gagatgtata acgaacgtgg ctcgattgcc gttaaggtgc gtatcactcc acgtgtcgca      2340
     cctggtgtgt ttgcgttggg tcagggtgcc tggtttaagc caggtaacac tgttggcagc      2400
     acgggtcaca tcatagatga aggcggcgcg atcaatacgc taacccgcta tcagccaagc      2460
     cctgtcgcta aaggcaaccc acagcacact aaccgtgttg caattaaaaa gatttaa         2517
//

If you have problems or comments...

PBIL Back to PBIL home page