(data stored in ACNUC7421 zone)

EMBL: CP000821.PE23

CP000821.PE23        Location/Qualifiers
FT   CDS_pept        complement(27258..29408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0023"
FT                   /product="fatty oxidation complex, alpha subunit FadB"
FT                   /note="KEGG: shn:Shewana3_0024 fatty oxidation complex,
FT                   alpha subunit FadB"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34636"
FT                   /db_xref="GOA:A8FP63"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FP63"
FT                   /protein_id="ABV34636.1"
FT                   /translation="MIYQSPTIQVELLEDNIARLCFNASGSVNKLDRETINSLDAALDA
FT                   IQQDSHIQALVLTSAKGAFIVGADITEFLGLFAQEDSVLLPWIAEANVVFNKLEDLPFP
FT                   TISAINGFALGGGFETVLATDFRIADTTAKIGLPETKLGLIPGFGGTVRLPRLIGTDNA
FT                   LEWITSGKDQRPEAALKVGAIDAVVAPENLQASAIKMLKDALAEKLDWQSRRARKQAAL
FT                   TLPKLEAMMSFATAKGMVFKIAGKHYPAPMAAISVIEQAARCGRADALKVEHQAFVKLA
FT                   KTDVAQALIGIFLNDQLVKGKAKKAGKLAKNIDTAAVLGAGIMGGGIAYQSASKGTPII
FT                   MKDIAQPALELGLGEASKLLAAQIKRGRSTPQKMAKVLNNITATLDYTPVKDVDVVVEA
FT                   VVEHPKVKSMVLAEVEQNVSDDAIITSNTSTISINLLAKSLKKPERFCGMHFFNPVHKM
FT                   PLVEVIRGENSSEETIASVVAYASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSGLLADG
FT                   ADFAAIDKVMEKQFGWPMGPAYLLDVVGIDTGHHAQAVMAEGFPDRMGKNGKDAIDIMF
FT                   EAERFGQKNSKGFYAYSVDRRGKPKKDVDPTSYELLGAEFGELKAFESEDIIARTMIPM
FT                   IIETVRCLEEGIIATPAEADMGLVFGLGFPPFRGGVFRYIDTMGVANFVALADKYAHLG
FT                   GLYQVTDAMRELAANNGSYYQS"
     atgatctacc aaagtcctac gattcaggtt gagttacttg aggataatat tgcccggtta        60
     tgctttaacg catcgggctc tgtcaataaa ctggatagag agacgattaa ctctctcgat       120
     gcagcattag acgcaattca gcaagactca cacattcaag cattagtact gacgtcagct       180
     aaaggtgctt ttattgtcgg tgccgatatc actgagtttc tcggcttatt tgctcaagaa       240
     gatagtgttc ttcttccatg gattgccgaa gctaacgtgg tattcaataa gttagaagat       300
     ctcccattcc caacaatttc agccattaac ggcttcgcat tgggtggtgg gttcgaaact       360
     gtgctggcaa ccgatttccg tattgccgat accacagcaa aaattggtct gccagaaact       420
     aagttgggct taattcctgg tttcggtggt accgttcgtc tacctcgcct tatcggtacc       480
     gataatgcgc tggagtggat aacatcgggt aaagatcaac gccctgaagc cgcattaaaa       540
     gttggcgcta tcgatgcggt tgttgctccc gaaaatttac aagcttcagc cattaagatg       600
     cttaaagatg cactggctga aaagctcgac tggcaatctc gccgcgcccg taaacaggcg       660
     gcactaacgc taccaaaatt agaagccatg atgtcatttg ctacagccaa aggcatggta       720
     ttcaagatag caggcaaaca ttacccggct ccaatggcgg caatcagtgt tatcgaacaa       780
     gccgcaagat gcggacgtgc tgacgcattg aaagttgaac accaagcctt tgttaagctg       840
     gccaagaccg acgttgcaca ggcattaatc ggtatattcc ttaacgacca actcgttaaa       900
     ggcaaggcaa agaaagccgg caagttagcg aaaaatatcg atacagcagc cgtactcggt       960
     gccggtatca tgggtggtgg tatcgcctat cagagtgcca gcaaaggcac tccgattatt      1020
     atgaaagata tcgcacaacc tgccctcgaa ttgggtctgg gcgaagcctc taagttactg      1080
     gccgctcaga tcaagcgtgg ccgttcgacg cctcagaaaa tggctaaggt cctcaataac      1140
     atcactgcga cccttgatta cacaccggtt aaagatgtcg acgttgtcgt agaagccgtt      1200
     gttgagcatc caaaagttaa gtctatggta ctggcagagg ttgaacaaaa cgttagtgat      1260
     gacgccatca tcacctcaaa cacctcgacc atctcgatca acctgctcgc taagagcctg      1320
     aagaagcctg agcgcttctg tggtatgcac ttctttaacc cggtgcataa gatgccactc      1380
     gttgaggtca ttcgtggtga gaatagttct gaagagacta tcgcttccgt tgtcgcttac      1440
     gccagcaaga tgggtaaaac acctatcgtt gttaacgact gccccggctt ctttgtaaac      1500
     cgcgtgctct ttccttactt tgcaggcttc agcggcctgc ttgcagacgg cgcagatttc      1560
     gccgctatcg ataaggtgat ggagaagcaa tttggctggc ctatgggtcc ggcctacctg      1620
     ctcgatgtag tcggtattga taccggtcat catgcacaag ccgttatggc cgaaggcttc      1680
     ccggatcgca tgggtaagaa tggtaaagat gctatcgata tcatgttcga agctgagcgc      1740
     ttcggacaga agaacagcaa aggtttctat gcttattcgg tcgaccgtcg cggcaagcca      1800
     aagaaagatg tcgacccaac cagctatgag ctattaggcg cagagtttgg tgagcttaag      1860
     gcatttgaat ctgaggatat tatcgcccgc accatgatcc ctatgattat cgaaacggtt      1920
     cgctgtctcg aagagggaat tattgcgact ccggcggaag ccgatatggg tctggtattt      1980
     ggtcttggat tcccgccatt cagaggtggt gtgttccgct atatcgatac catgggtgta      2040
     gctaacttcg tggcacttgc cgataaatat gctcacctag gtggcctata tcaagtaacc      2100
     gatgccatgc gcgaactcgc cgctaataac ggcagctact accagtctta a               2151
//

If you have problems or comments...

PBIL Back to PBIL home page