(data stored in ACNUC7421 zone)

EMBL: CP000821.PE230

CP000821.PE230       Location/Qualifiers
FT   CDS_pept        266320..266997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0230"
FT                   /product="anaerobic dimethyl sulfoxide reductase, B
FT                   subunit"
FT                   /note="KEGG: son:SO1430 anaerobic dimethyl sulfoxide
FT                   reductase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34843"
FT                   /db_xref="InterPro:IPR014297"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPS0"
FT                   /protein_id="ABV34843.1"
FT                   /translation="MTQPTQYGFYVDSTKCSGCKACHVSCKDRQSNEIRNNSNPEGNAL
FT                   PALEGVTWRRVYEYGGGEWTKGNNGCFEQNVFAYYMSIGCNHCSEPVCVKACPTGAMHK
FT                   RREDGLVHVAQELCIGCESCARACPYDAPQIDRERKVMTKCDGCFERIAEGRKPVCVES
FT                   CPLRALDFDTMDNLRAKYGDGDGHIAPLPSPSITSPNLIIKANVNGRPAGSGEGQILNL
FT                   SEV"
     atgactcaac caactcaata tggtttttat gtagacagca ctaagtgcag tggctgtaaa        60
     gcatgtcacg tgtcttgcaa agaccgtcaa agcaacgaaa ttcgtaataa cagcaacccg       120
     gaaggcaatg ccttacctgc actcgagggc gtaacctggc gtcgtgtgta tgagtatggt       180
     ggcggagagt ggaccaaagg taacaatggc tgttttgagc aaaatgtatt tgcttattac       240
     atgtctatcg gctgtaacca ttgctctgag ccagtatgtg tgaaagcctg ccctaccggc       300
     gctatgcata aacgtcgtga agatggtctg gttcacgtgg ctcaagagct gtgtatcggt       360
     tgtgagagct gtgctcgagc atgtccatac gatgcgccgc aaattgatcg cgaacgtaaa       420
     gtgatgacta agtgtgatgg ctgcttcgag cgaatcgccg aaggtcgtaa gcctgtgtgt       480
     gtcgagtctt gcccgctacg tgcactggac ttcgatacta tggataacct acgcgctaaa       540
     tatggcgatg gagacggtca tattgctccg ctgccatcac cttcaatcac ttcgcctaac       600
     ctgataatca aggctaacgt caatggccgt ccggctggca gtggtgaagg gcagatctta       660
     aacttatctg aagtttaa                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page