(data stored in ACNUC7421 zone)

EMBL: CP000821.PE231

CP000821.PE231       Location/Qualifiers
FT   CDS_pept        267075..267734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0231"
FT                   /product="cytoplasmic chaperone TorD family protein"
FT                   /note="KEGG: sfr:Sfri_3682 cytoplasmic chaperone TorD
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34844"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPS1"
FT                   /protein_id="ABV34844.1"
FT                   /translation="MPSINTFDFQAGQGIARILHNVLLSYPTGELLNNFKQYEVVETWP
FT                   EFGQSQDNQTGKAALSRYLSLYSDEQLDELKLDYGQLFFGPEEPKAMPWGSVYLGEAQL
FT                   LNDRSTLDLIAFYKQQGIEFELEYNQPQDHIALFFSVIDRLLGLLVENPDDESVRRTLS
FT                   VLLQHHMLPWSHRCLELAIEHSQTDFYSGIAHLALDFQKVLAEVFQVIPMPVRLYR"
     atgccatcaa tcaacacatt cgattttcaa gcaggccaag ggatagcacg tattctgcac        60
     aacgtcctgc tcagttatcc gacaggcgaa ctgttgaata actttaagca atatgaggtc       120
     gtagagacct ggcccgagtt cggtcaatca caagataacc aaacgggaaa agcagcactg       180
     agtcggtatc tgtctctgta ctcggatgag cagttagatg agttgaaact cgattatggt       240
     cagctatttt tcggacccga agaacccaaa gccatgccct ggggctcggt atacctggga       300
     gaggcgcaac tactcaacga cagatcgaca ctagacttga tagccttcta taagcagcaa       360
     gggatcgaat ttgagctgga gtacaatcag ccgcaggatc atattgccct gtttttttcc       420
     gtgatcgatc ggcttctggg cctgttagtc gaaaatcccg atgatgaatc cgtacgacga       480
     accttgagtg tgctactgca gcatcatatg ttgccatggt cacatcgctg cctcgagttg       540
     gccattgagc attcacaaac cgatttctat tcaggcattg cccatctggc gctggacttt       600
     caaaaggtat tagctgaagt gtttcaggtg atccccatgc cggttcgttt gtatcgatag       660
//

If you have problems or comments...

PBIL Back to PBIL home page