(data stored in ACNUC7421 zone)

EMBL: CP000821.PE232

CP000821.PE232       Location/Qualifiers
FT   CDS_pept        267775..268251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0232"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34845"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPS2"
FT                   /protein_id="ABV34845.1"
FT                   /translation="MSVIKAFGQQHTKAEFAYLLQGYLSQSAEVCELFTGATNMTTVVN
FT                   LIAALSYRESDERFAVTSLDTELVFSVLFDGFHLLFIKEVQHGSLNQAEHLILRLTQYY
FT                   AAKLEADFVPELTDGSRTEQHLELRNKLKQVLIASSQLDDLYLQRRGMQSNMGR"
     atgagcgtga ttaaggcatt tggccagcaa catactaaag ccgagtttgc ctacctgttg        60
     caaggctatt taagtcagag tgccgaagtg tgcgagctgt tcaccggtgc cactaacatg       120
     actaccgtgg ttaatcttat tgccgcattg agctatcggg agagtgacga gcgttttgct       180
     gtgacctcac tcgacaccga gctggtgttt tccgtgttat tcgatggctt tcacctgttg       240
     tttatcaaag aggttcagca tggctcttta aatcaggccg agcatcttat tctgcggtta       300
     acgcaatatt atgcggcgaa actcgaagct gattttgtac ctgaactaac tgatggctct       360
     cgaacagagc agcatcttga gcttagaaat aaattaaagc aggtgcttat agcatcgtca       420
     caactggatg atttatatct gcaaaggcga gggatgcaga gtaacatggg gcgttaa          477
//

If you have problems or comments...

PBIL Back to PBIL home page