(data stored in ACNUC7421 zone)

EMBL: CP000821.PE233

CP000821.PE233       Location/Qualifiers
FT   CDS_pept        complement(268291..269031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0233"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: son:SO1415 transcriptional regulator, TetR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34846"
FT                   /db_xref="GOA:A8FPS3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPS3"
FT                   /protein_id="ABV34846.1"
FT                   /translation="MANRTSLKRQRISAILDSAEKAIVENGLFSLSLLELARQSGCSVN
FT                   TLYNYFSNREDIAVSLFNRYIGKWGVQASREISQHRYSFAERFLAMQMIWVYRQHRDID
FT                   EGGVQFLAAIPCVWKHASHQRISTTRQLLDTWFTLNREFLMMAREQGEMTASDAQIDEC
FT                   LLMVSITERGFSLLANNYLFRENIINMPLSKIFDSMNEELKQLEWKTAISDSSFNRVLE
FT                   LVTHVNEQLSDHHIDNLIYDIEDK"
     atggccaaca gaaccagttt aaaaagacaa cgaatttcag cgatattaga ttcagccgaa        60
     aaagccatag tagaaaatgg acttttctcc ctgagcctac tggaactcgc caggcagtca       120
     ggttgctcgg tgaacaccct ctataattat ttttccaata gggaagatat tgccgtgagt       180
     ctgtttaacc gctatatcgg aaagtgggga gttcaggcca gtcgggagat aagtcagcat       240
     agatatagtt tcgccgagcg ctttctcgcg atgcagatga tctgggtata tcgtcaacat       300
     cgggatattg atgaaggtgg agtacagttc ctggccgcaa tcccctgcgt atggaagcac       360
     gcatcccatc agaggatctc gacaaccaga cagctcttgg atacctggtt tactctaaac       420
     agagagttct taatgatggc aagggaacag ggggagatga cggcatcaga tgctcagatt       480
     gatgaatgct tacttatggt atcaatcacc gaaagaggct tttctttatt agctaataat       540
     tatctattcc gtgaaaacat aataaacatg ccacttagca aaatatttga ttcgatgaat       600
     gaagagttaa aacagttaga gtggaaaaca gcaattagtg atagtagttt taatcgtgta       660
     ttagagttag tcacacatgt aaatgaacag ctatccgatc accatattga caaccttata       720
     tatgatatcg aagataaata a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page