(data stored in ACNUC7421 zone)

EMBL: CP000821.PE234

CP000821.PE234       Location/Qualifiers
FT   CDS_pept        269290..269898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0234"
FT                   /product="thiol:disulfide interchange protein, DsbA family"
FT                   /note="KEGG: son:SO3871 thiol:disulfide interchange
FT                   protein, DsbA family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34847"
FT                   /db_xref="GOA:A8FPS4"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPS4"
FT                   /protein_id="ABV34847.1"
FT                   /translation="MIKLLSTAAILLSFGASAASFTQGEHYVDLGEAAFNAPNQVTKVY
FT                   SVNCPFCYKYEKAVIPGFVKNLPDGVSFDSYHITTKPPFGKEKATVIAVAKVLGDKQYK
FT                   TAKMAYYKHIHDDKKKFSSAEDAISFGLKAAKIDSVTFSAHKDTSEVKALLTQWDQGVA
FT                   VAKVRGIPAIVVNGKYLINTKTITSMTMLDELTAELLEK"
     atgataaaac ttctttctac tgcggctatc ctgctttcgt ttggtgcatc cgcggccagc        60
     ttcactcaag gtgagcatta cgttgacctg ggtgaggcgg cgttcaatgc acctaatcaa       120
     gtgaccaaag tttactcggt taactgccca ttctgttaca aatatgaaaa agcggtcata       180
     cccggttttg ttaaaaactt gccggatgga gtgagcttcg actcctatca catcacgact       240
     aagccccctt tcggcaaaga gaaggcgacg gtaatagcgg tggctaaggt attgggcgat       300
     aagcagtata aaacggccaa gatggcttat tacaaacaca ttcatgacga taagaaaaag       360
     tttagctctg ccgaagatgc gatctccttt ggtttgaaag ccgcgaagat agatagtgtg       420
     actttctctg cccacaagga tacatcagag gtgaaagcgc tactgactca atgggatcag       480
     ggagtggccg tggctaaggt gagaggcatt ccggctatcg tggttaatgg taagtattta       540
     atcaacacaa aaactatcac cagcatgaca atgctcgatg agttgactgc tgaactgttg       600
     gagaaatag                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page