(data stored in ACNUC7421 zone)

EMBL: CP000821.PE235

CP000821.PE235       Location/Qualifiers
FT   CDS_pept        269907..270542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0235"
FT                   /product="disulfide bond formation protein"
FT                   /note="KEGG: son:SO3870 disulfide bond formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34848"
FT                   /db_xref="GOA:A8FPS5"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPS5"
FT                   /protein_id="ABV34848.1"
FT                   /translation="MNAISQGWQDLKTAPVSTLQQWQEQRWIWLLMSGAAAFLIGSAMG
FT                   YFQWFLEMDPCEICVYIRFSQFCILFAGLVIAINPNQVLLKVLGLTLAWYGVVQGMMWS
FT                   IDLSMLHDASHAMDDVMAGGGDLFAAGGGGGACSTEPTFPLGLPLHEWFPYEFQPSGIC
FT                   GEDDWSLLGLNMAQYCIIAYSVFGIALSAVTFGWISRLTQGHSSVKAH"
     atgaatgcta tttcacaagg ttggcaggac cttaaaactg caccagttag cacactacag        60
     caatggcaag agcaacgttg gatatggctc ctgatgagtg gcgcagccgc atttctaatc       120
     ggctcggcga tgggatattt ccagtggttc ctggagatgg acccatgtga gatatgtgtc       180
     tacattcgat tcagccagtt ctgcatcctc tttgctggtc tggtcatagc cataaaccct       240
     aatcaagtat tacttaaagt cctgggcctg acactggcct ggtatggcgt cgtgcaaggc       300
     atgatgtggt cgattgacct gtctatgctg cacgatgcat cacatgcgat ggatgatgtg       360
     atggcgggtg gtggagacct ctttgccgca ggcggcggtg gaggtgcttg ctctacagaa       420
     ccaacattcc cactgggctt acctctgcat gagtggttcc cctatgaatt tcaaccatcg       480
     ggtatctgcg gtgaagatga ttggagttta ttgggactca atatggcgca gtattgcatc       540
     atcgcctact cggtctttgg tatcgcactc agcgccgtga cgtttggctg gatctccagg       600
     ctcactcaag ggcattcgag cgttaaggct cactaa                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page