(data stored in ACNUC7421 zone)

EMBL: CP000821.PE236

CP000821.PE236       Location/Qualifiers
FT   CDS_pept        270603..271346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0236"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vfi:VF0719 putative sugar hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34849"
FT                   /db_xref="GOA:A8FPS6"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPS6"
FT                   /protein_id="ABV34849.1"
FT                   /translation="MKYLRNVIALSLLAAAPASQAGMLAVEAGVMDWSQQAEDYFGEGK
FT                   SENSFIQMKGATGSAFGDLYAHVKLEDIEDSAAIGSEINIVGQINMGDSDFNWYGQVFN
FT                   KQKPVWSETNTTLGVSWDKQFDNGLYAQLALAGHIVTADYKHFNSDFKGGFNGGYFIYT
FT                   LMKDFDIGDQNFSFVWWQEHFFGRDDLYLKLSGDGKDFGFNGSAILRWHFHEQISAALT
FT                   YRYAENNMGKEGFHDGVFYSLQYNF"
     atgaagtact tgcgtaatgt gatagcgctg agtttgcttg cggctgcgcc ggcctcacag        60
     gctggaatgc tggcggttga agcgggagtg atggactgga gccaacaggc tgaagattat       120
     tttggtgagg gcaagagcga gaacagcttt atacagatga aaggcgccac gggaagtgca       180
     tttggcgacc tgtatgcaca cgtgaagctg gaagatatcg aagattccgc ggctatagga       240
     tctgagatca atatcgtcgg tcagatcaat atgggagaca gtgattttaa ttggtatggc       300
     caggtattca ataagcagaa acccgtctgg tccgagacca ataccacctt aggagtgagc       360
     tgggacaagc agttcgataa cggtttgtat gctcagctgg cgctggcagg ccacatagtc       420
     actgcggact ataagcactt caactccgac ttcaaggggg gattcaacgg ggggtatttt       480
     atctacaccc tgatgaagga cttcgatatc ggtgatcaga atttttcctt tgtctggtgg       540
     caggagcact tttttggccg ggatgacctc tatttgaagc tctccggtga tggcaaagat       600
     tttggtttta atggttcggc tatcttgcgt tggcattttc atgagcagat ctccgcagcc       660
     ctgacctacc gctatgcaga aaacaatatg gggaaagagg gttttcatga cggcgtgttc       720
     tattcattgc aatacaactt ttaa                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page