(data stored in ACNUC7421 zone)

EMBL: CP000821.PE238

CP000821.PE238       Location/Qualifiers
FT   CDS_pept        273869..274867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0238"
FT                   /product="transcriptional regulator-like protein"
FT                   /note="KEGG: saz:Sama_2899 transcriptional regulator-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34851"
FT                   /db_xref="GOA:A8FPS8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPS8"
FT                   /protein_id="ABV34851.1"
FT                   /translation="MRKELSRLDYFTLKVLIGLFEFKSCSVVAEKLNTTQPKVSRALSC
FT                   LREVIQNELFVRQQYGLQPNSMAEKIYPLAKSIVATLEEIDLVAMSEPDTRRVVNVAVQ
FT                   EHMSAFFLEAISEASVHLNQEVVVNVQSWCDNVSQLIAQGKLDYAITVNSTYHEMIENL
FT                   ELGEVRYRFVVAKKGHPIFRKPLSYSGLIENRLVFINYCQVGSKPNWFESSVKLRGEEL
FT                   KLTLKTSSLNMALDHIVKSDDVCCTASIFAYQNFKNRDDTDFFDATDFSHVELAKAKKE
FT                   LAPAEHQKDYYYLQYHHSNEHEFTHLLSEIMKRKLDLMQDEYEQAKSLVAS"
     atgcgaaagg aactctctag gttagattat ttcactctta aagtgctcat cggtttattt        60
     gagtttaaga gttgcagtgt cgtggctgag aaactaaata caactcagcc taaagtcagc       120
     cgcgccttga gctgtctccg tgaagtgatc cagaatgaat tatttgtgcg tcagcagtat       180
     ggcttacagc caaattcgat ggccgaaaaa atctatcccc tggctaaatc gatagtcgct       240
     acactggaag agatagacct tgtggctatg agtgaaccgg atacgagacg tgtcgtaaat       300
     gtcgcggttc aggagcatat gtctgcattt tttttggagg caatatcgga agccagcgtt       360
     catttgaacc aggaagtagt cgtcaatgtt cagtcctggt gtgacaatgt ttcccagctg       420
     attgctcagg gcaagcttga ctatgcgatt acagtcaatt caacttacca cgagatgata       480
     gaaaacctcg aactggggga ggtgcgttat cggttcgtcg tcgccaagaa aggtcatccc       540
     atttttcgaa agcccctgag ctactcaggg cttatcgaga atcgactggt tttcatcaat       600
     tactgccaag tgggctcgaa gcctaactgg ttcgaatcca gtgtgaagct gcggggtgag       660
     gaattaaagc taaccttaaa gacctctagt ctcaacatgg cgctggatca tatcgttaaa       720
     tccgatgatg tgtgttgtac tgcatccatt tttgcctatc aaaattttaa gaatcgtgat       780
     gatactgact ttttcgatgc cacagacttc agtcatgttg agttagctaa ggctaaaaaa       840
     gagttggcgc cggcagagca tcaaaaagat tattattacc tgcaatatca tcattctaat       900
     gagcatgaat ttactcatct tttgtcggaa ataatgaagc gtaaacttga cttgatgcaa       960
     gacgaatatg aacaagctaa atcactcgtc gcgagctaa                              999
//

If you have problems or comments...

PBIL Back to PBIL home page