(data stored in ACNUC7421 zone)

EMBL: CP000821.PE240

CP000821.PE240       Location/Qualifiers
FT   CDS_pept        276582..277082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34853"
FT                   /db_xref="GOA:A8FPT0"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPT0"
FT                   /protein_id="ABV34853.1"
FT                   /translation="MNASVIFSYAFMYFVLFLVVPFVLVTFTMTCIKFFKPNDTESVGA
FT                   KIKFSRHPMEPKSVGFINKLNTIVKDKYNVLYGTCLDSILDIDKAETPDDVHSYLRGCH
FT                   LDYVLVDSESSSVKLVITDPEHNSPEQSEFIDNSLAEVGVKVIHLAKNQKWDESLIRNG
FT                   LAA"
     atgaatgcat cagtaatttt tagctatgct tttatgtact ttgtattatt ccttgtggtg        60
     ccatttgttc tagtgacatt caccatgacc tgtataaagt tttttaaacc aaacgatacg       120
     gaatccgtag gagctaaaat aaagtttagc cgtcacccaa tggaacctaa gtcggttggg       180
     tttattaata agttgaatac gatcgttaaa gataaataca atgttttata tggaacctgt       240
     ctcgatagca tactggatat tgacaaagcg gaaacgcctg acgatgtcca ctcctatttg       300
     agaggatgtc atctggatta tgtcctggtc gacagtgaat catcatcggt aaaactggtg       360
     atcaccgacc ctgagcataa ctcacccgag caatctgaat ttatcgataa ttcattagca       420
     gaagtcgggg ttaaggtcat tcacctcgcc aagaatcaaa agtgggatga aagtcttatc       480
     agaaacggct tggccgcata g                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page