(data stored in ACNUC7421 zone)

EMBL: CP000821.PE241

CP000821.PE241       Location/Qualifiers
FT   CDS_pept        277170..277643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: saz:Sama_2902 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34854"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPT1"
FT                   /protein_id="ABV34854.1"
FT                   /translation="MSKIDRFVTPLLASILMLVLGSFSPAATAGKVELKINQNKQCIMC
FT                   HKRNGKMFGLHANDALDLTCQNCHGEKAGHPRKASELIGFSAKSVAEPAVQTAACLQCH
FT                   DVETLSQADWTHDVHSNKVNCASCHQLHPEVDPIIGVTALDRSELCSGCHSAK"
     atgtccaaaa ttgatagatt cgtcactccg ctactggctt caatactcat gttggtgctg        60
     ggatccttct ctcctgcagc gactgctggg aaagtggagt taaaaataaa ccagaataaa       120
     caatgcatca tgtgccataa gcgcaacgga aaaatgtttg gacttcatgc taatgatgca       180
     ttggatctaa cctgccaaaa ttgccatggt gaaaaggctg gtcatccgag gaaagcatcc       240
     gagctaatcg gatttagtgc taaatctgtc gccgaacctg ccgttcaaac tgccgcatgt       300
     cttcaatgcc atgatgttga aacgctgagt caggccgatt ggacccacga tgtgcattcc       360
     aacaaggtta attgtgccag ttgccatcag ttacaccctg aagtcgatcc tatcataggc       420
     gtgacagcgc ttgatcgtag cgaattgtgc agcggctgcc atagtgccaa ataa             474
//

If you have problems or comments...

PBIL Back to PBIL home page