(data stored in ACNUC7421 zone)

EMBL: CP000821.PE244

CP000821.PE244       Location/Qualifiers
FT   CDS_pept        279296..279586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0244"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_2184 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34857"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPT4"
FT                   /protein_id="ABV34857.1"
FT                   /translation="MFKALGLSILISFSGAVFAGGIADSHAEMSGCESCHEDGAPSDDG
FT                   AFENEACASCHGPLKEFDSDVHNKHEGALLCNDCHVVHEEALAKDSCDNCH"
     atgtttaaag ccttagggtt atcaatatta ataagttttt ctggagctgt atttgcgggg        60
     ggaattgccg attctcatgc cgaaatgtca ggctgtgaat cctgccatga ggacggggcc       120
     ccctcggacg atggggcttt tgaaaatgaa gcttgtgcct cttgccacgg gcccttgaag       180
     gaatttgata gtgatgttca taataaacat gaaggcgcct tgttgtgtaa tgactgccat       240
     gtggtgcatg aggaggcatt ggctaaggat tcctgcgaca attgtcacta a                291
//

If you have problems or comments...

PBIL Back to PBIL home page